@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1478: (2016-05-02 )
MRHTRFHPIKLAWITAVVAGLMVGVATPADAEPGQWDPTLPALVSAGAPGDPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGASRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGPSKGVDSGANTVGFDCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGGGQHVTLYLGNGQMLEASGSAGKVTVSPVRKAGMTPFVTRIIEY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UNL_A_4(2HBW)
?
[Raw transfer]




FMT_A_3(4Q4T)
RIPA_MYCTU
[Raw transfer]




GOL_A_4(4Q4T)
RIPA_MYCTU
[Raw transfer]




GOL_A_3(3M1U)
?
[Raw transfer]




23 HHSearch 95.94100% -95 - C3 -3PBI - RIPB_MYCTU -
1 PsiBlast_PDB 95.94100% -95 - C3 -3PBI - RIPB_MYCTU -
7 PsiBlast_PDB 81.6859% -80 - C3 -3S0Q - RIPA_MYCTU -
4 PsiBlast_PDB 81.4859% -82 - C3 -4Q4T 3.7 RIPA_MYCTU
2 PsiBlast_PDB 81.3260% -80 - C3 -3PBC - RIPA_MYCTU -
5 PsiBlast_PDB 80.9559% -79 - C3 -4Q4N - -
3 PsiBlast_PDB 80.5660% -77 - C3 -3NE0 - -
6 PsiBlast_PDB 80.2159% -80 - C3 -4Q4G - -
21 PsiBlast_CBE 75.3685%-111 - C3 -3I86 - ? -
9 PsiBlast_PDB 74.9785%-112 - C3 -3I86 - ? -
24 HHSearch 74.8869%-109 - C3 -4Q4G - -
12 PsiBlast_PDB 72.6751%-114 - C3 -3GT2 - ? -
11 PsiBlast_PDB 71.6653%-109 - C3 -4JXB - ? -
25 HHSearch 71.0755%-113 - C3 -4LJ1 - ? -
22 PsiBlast_CBE 70.7553%-111 - C3 -4JXB - ? -
10 PsiBlast_PDB 70.6753%-116 - C3 -4LJ1 - ? -
31 HHSearch 58.7034%-109 * C3 *2HBW 4.2 ?
16 PsiBlast_PDB 57.4034%-102 - C3 -2FG0 - ? -
8 PsiBlast_PDB 57.1959% -33 - C- -2XIV - -
15 PsiBlast_PDB 56.3334% -98 - C3 -2EVR - ? -
36 HHSearch 45.6633% -94 - C3 -3M1U 3.1 ?