@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1542c: (2016-05-02 )
MGLLSRLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAPV

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEC_A_7(1S56)
TRHBN_MYCTU
[Raw transfer]




HEM_B_9(2GLN)
TRHBN_MYCTU
[Raw transfer]




HEM_B_11(1S61)
TRHBN_MYCTU
[Raw transfer]




HEM_A_8(2GLN)
TRHBN_MYCTU
[Raw transfer]




HEM_A_6(2GKN)
TRHBN_MYCTU
[Raw transfer]




HEM_A_2(5AB8)
TRHBN_MYCTU
[Raw transfer]




HEM_B_8(1S56)
TRHBN_MYCTU
[Raw transfer]




HEM_B_10(2GL3)
TRHBN_MYCTU
[Raw transfer]




HEM_B_14(1RTE)
TRHBN_MYCTU
[Raw transfer]




HEC_A_10(1S61)
TRHBN_MYCTU
[Raw transfer]




HEM_A_6(1IDR)
TRHBN_MYCTU
[Raw transfer]




HEM_A_9(2GL3)
TRHBN_MYCTU
[Raw transfer]




HEM_B_7(2GKM)
TRHBN_MYCTU
[Raw transfer]




HEM_A_13(1RTE)
TRHBN_MYCTU
[Raw transfer]




HEM_A_6(2GKM)
TRHBN_MYCTU
[Raw transfer]




HEM_A_2(5AB8)
TRHBN_MYCTU
[Raw transfer]




HEM_B_7(1IDR)
TRHBN_MYCTU
[Raw transfer]




HEM_B_7(1IDR)
TRHBN_MYCTU
[Raw transfer]




HEM_B_7(2GKN)
TRHBN_MYCTU
[Raw transfer]




OXY_A_4(3AQ5)
TRHBN_TETPY
[Raw transfer]




OXY_B_6(3AQ5)
TRHBN_TETPY
[Raw transfer]




XE_A_4(1UVX)
TRHN1_CHLMO
[Raw transfer]




XE_A_7(1UVX)
TRHN1_CHLMO
[Raw transfer]




FLC_A_2(1S69)
TRHBN_SYNY3
[Raw transfer]




21 PsiBlast_CBE 98.40100%-150 - C6 -1S61 12.5 TRHBN_MYCTU
22 PsiBlast_CBE 96.72100%-146 - C6 -1S56 10.6 TRHBN_MYCTU
26 PsiBlast_CBE 96.6099%-149 - C6 -2GLN 10.0 TRHBN_MYCTU
28 PsiBlast_CBE 95.1798%-163 - C6 -2GL3 12.5 TRHBN_MYCTU
23 PsiBlast_CBE 94.68100%-162 - C6 -1RTE 12.1 TRHBN_MYCTU
25 PsiBlast_CBE 94.2399%-160 - C6 -2GKM 13.0 TRHBN_MYCTU
24 PsiBlast_CBE 93.81100%-158 - C6 -1IDR 12.9 TRHBN_MYCTU
77 Fugue 93.70100%-160 - C6 -1IDR 12.9 TRHBN_MYCTU
27 PsiBlast_CBE 93.6899%-162 - C6 -2GKN 11.8 TRHBN_MYCTU
2 PsiBlast_PDB 93.46100%-157 - C6 -1S56 12.0 TRHBN_MYCTU
5 PsiBlast_PDB 93.4199%-160 - C6 -2GKM 12.8 TRHBN_MYCTU
6 PsiBlast_PDB 93.2199%-153 - C6 -2GLN 11.8 TRHBN_MYCTU
1 PsiBlast_PDB 92.72100%-156 - C6 -1IDR 11.7 TRHBN_MYCTU
8 PsiBlast_PDB 92.7198%-158 - C6 -2GL3 12.4 TRHBN_MYCTU
7 PsiBlast_PDB 92.6499%-161 - C6 -2GKN 11.9 TRHBN_MYCTU
4 PsiBlast_PDB 92.44100%-151 - C6 -1RTE 12.5 TRHBN_MYCTU
3 PsiBlast_PDB 91.38100%-149 - C6 -1S61 11.1 TRHBN_MYCTU
9 PsiBlast_PDB 89.65100%-160 - C6 -5AB8 12.3 TRHBN_MYCTU
62 HHSearch 89.35100%-161 - C6 -5AB8 12.3 TRHBN_MYCTU
78 Fugue 73.3835%-150 * C6 *1DLW - TRHBN_PARCA -
30 PsiBlast_CBE 70.0635%-151 - C6 -3AQ5 3.1 TRHBN_TETPY
11 PsiBlast_PDB 69.7440%-157 - C6 -1UVX 2.8 TRHN1_CHLMO
14 PsiBlast_PDB 69.6035%-146 - C6 -3AQ5 3.0 TRHBN_TETPY
38 PsiBlast_CBE 63.0634%-141 - C6 -1S69 3.1 TRHBN_SYNY3