@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1657: (2016-05-03 )
MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_C_23(3FHZ)
ARGR_MYCTU
[Raw transfer]




ARG_F_12(2ZFZ)
ARGR_MYCTU
[Raw transfer]




ARG_F_12(3CAG)
ARGR_MYCTU
[Raw transfer]




ARG_E_11(2ZFZ)
ARGR_MYCTU
[Raw transfer]




ARG_E_11(3CAG)
ARGR_MYCTU
[Raw transfer]




ARG_F_18(3LAJ)
ARGR_MYCTU
[Raw transfer]




GGB_E_25(3LAP)
ARGR_MYCTU
[Raw transfer]




GGB_F_26(3LAP)
ARGR_MYCTU
[Raw transfer]




ARG_E_17(3LAJ)
ARGR_MYCTU
[Raw transfer]




ARG_B_4(2P5M)
ARGR_BACSU
[Raw transfer]




ARG_E_17(3FHZ)
ARGR_MYCTU
[Raw transfer]




ARG_F_18(3FHZ)
ARGR_MYCTU
[Raw transfer]




ARG_F_18(3FHZ)
ARGR_MYCTU
[Raw transfer]




ARG_F_12(2ZFZ)

[Raw transfer]




ARG_F_12(3CAG)

[Raw transfer]




ARG_F_18(3LAJ)
ARGR_MYCTU
[Raw transfer]




GGB_F_26(3LAP)
ARGR_MYCTU
[Raw transfer]




ARG_F_12(2ZFZ)
ARGR_MYCTU
[Raw transfer]




ARG_D_10(3CAG)
ARGR_MYCTU
[Raw transfer]




ARG_D_10(2ZFZ)
ARGR_MYCTU
[Raw transfer]




ARG_F_12(2ZFZ)
ARGR_MYCTU
[Raw transfer]




ARG_E_11(3CAG)
ARGR_MYCTU
[Raw transfer]




ARG_F_12(3CAG)
ARGR_MYCTU
[Raw transfer]




ARG_F_11(1B4B)
ARGR_GEOSE
[Raw transfer]




ARG_E_17(3FHZ)
ARGR_MYCTU
[Raw transfer]




GGB_D_22(3LAP)
ARGR_MYCTU
[Raw transfer]




ARG_D_16(3LAJ)
ARGR_MYCTU
[Raw transfer]




ARG_E_11(2ZFZ)
ARGR_MYCTU
[Raw transfer]




GGB_F_26(3LAP)
ARGR_MYCTU
[Raw transfer]




GGB_E_25(3LAP)
ARGR_MYCTU
[Raw transfer]




ARG_F_18(3FHZ)
ARGR_MYCTU
[Raw transfer]




ARG_F_18(3LAJ)
ARGR_MYCTU
[Raw transfer]




GGB_F_26(3LAP)
ARGR_MYCTU
[Raw transfer]




ARG_F_11(1B4B)
ARGR_GEOSE
[Raw transfer]




ARG_E_17(3LAJ)
ARGR_MYCTU
[Raw transfer]




ARG_D_14(1XXA)
ARGR_ECOLI
[Raw transfer]




32 PsiBlast_CBE 92.54100%-145 - C10 -3FHZ 2.1 ARGR_MYCTU
33 PsiBlast_CBE 91.80100%-126 - C10 -3FHZ 3.1 ARGR_MYCTU
35 PsiBlast_CBE 91.35100%-132 - C10 -3FHZ 2.7 ARGR_MYCTU
31 PsiBlast_CBE 91.34100%-145 - C10 -3FHZ 3.9 ARGR_MYCTU
2 PsiBlast_PDB 91.23100%-145 - C10 -3FHZ Error ARGR_MYCTU
34 PsiBlast_CBE 91.10100%-133 - C10 -3FHZ 2.9 ARGR_MYCTU
26 PsiBlast_CBE 89.55100%-138 - C10 -3LAJ 2.3 ARGR_MYCTU
30 PsiBlast_CBE 88.91100%-138 - C10 -3LAJ 2.5 ARGR_MYCTU
28 PsiBlast_CBE 88.83100%-136 - C10 -3LAJ 3.1 ARGR_MYCTU
1 PsiBlast_PDB 88.78100%-127 - C10 -3ERE - ARGR_MYCTU -
27 PsiBlast_CBE 88.76100%-137 - C10 -3LAJ 2.3 ARGR_MYCTU
23 PsiBlast_CBE 88.71100%-135 - C10 -3LAP 3.7 ARGR_MYCTU
22 PsiBlast_CBE 88.64100%-137 - C10 -3LAP 2.5 ARGR_MYCTU
3 PsiBlast_PDB 88.54100%-135 - C10 -3LAJ 2.8 ARGR_MYCTU
21 PsiBlast_CBE 88.48100%-136 - C10 -3LAP 2.7 ARGR_MYCTU
29 PsiBlast_CBE 88.34100%-134 - C10 -3LAJ 2.8 ARGR_MYCTU
25 PsiBlast_CBE 87.96100%-134 - C10 -3LAP 3.0 ARGR_MYCTU
4 PsiBlast_PDB 87.85100%-133 - C10 -3LAP 3.3 ARGR_MYCTU
76 HHSearch 87.7499%-134 - C10 -3LAP 3.3 ARGR_MYCTU
24 PsiBlast_CBE 87.59100%-134 - C10 -3LAP 3.3 ARGR_MYCTU
44 PsiBlast_CBE 70.74100%-137 - C10 -2ZFZ 3.1 ARGR_MYCTU
43 PsiBlast_CBE 70.74100%-130 - C10 -2ZFZ 3.6 ARGR_MYCTU
39 PsiBlast_CBE 70.66100%-133 - C10 -3CAG 2.9 ARGR_MYCTU
6 PsiBlast_PDB 69.87100%-138 - C10 -3CAG 3.1 ARGR_MYCTU
42 PsiBlast_CBE 69.85100%-140 - C10 -2ZFZ 3.7 ARGR_MYCTU
78 HHSearch 69.11100%-140 - C10 -2ZFZ 3.0 ARGR_MYCTU
7 PsiBlast_PDB 69.11100%-140 - C10 -2ZFZ 3.0 ARGR_MYCTU
37 PsiBlast_CBE 68.28100%-135 - C10 -3CAG 2.6 ARGR_MYCTU
38 PsiBlast_CBE 68.20100%-135 - C10 -3CAG 2.4 ARGR_MYCTU
40 PsiBlast_CBE 67.94100%-131 - C10 -3CAG 3.1 ARGR_MYCTU
36 PsiBlast_CBE 67.84100%-136 - C10 -3CAG 2.8
41 PsiBlast_CBE 67.45100%-135 - C10 -2ZFZ 3.0
45 PsiBlast_CBE 66.27100%-131 - C10 -2ZFZ 3.1 ARGR_MYCTU
79 HHSearch 52.0630%-125 - C10 -2P5M 3.3 ARGR_BACSU
80 HHSearch 49.8636%-119 * C10 *1B4B 2.3 ARGR_GEOSE
65 Fugue 49.7035%-122 - C10 -1B4B 2.3 ARGR_GEOSE
81 HHSearch 48.8733%-126 - C10 -1XXA 2.8 ARGR_ECOLI