@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1785c: (2016-05-05 )
MTTPGEDHAGSFYLPRLEYSTLPMAVDRGVGWKTLRDAGPVVFMNGWYYLTRREDVLAALRNPKVFSSRKALQPPGNPLPVVPLAFDPPEHTRYRRILQPYFSPAALSKALPSLRRHTVAMIDAIAGRGECEAMADLANLFPFQLFLVLYGLPLEDRDRLIGWKDAVIAMSDRPHPTEADVAAARELLEYLTAMVAERRRNPGPDVLSQVQIGEDPLSEIEVLGLSHLLILAGLDTVTAAVGFSLLELARRPQLRAMLRDNPKQIRVFIEEIVRLEPSAPVAPRVTTEPVTVGGMTLPAGSPVRLCMAAVNRDGSDAMSTDELVMDGKVHRHWGFGGGPHRCLGSHLARLELTLLVGEWLNQIPDFELAPDYAPEIRFPSKSFALKNLPLRWS

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_A_2(3NV6)
?
[Raw transfer]




HEM_A_2(3NV5)
?
[Raw transfer]




HEM_A_2(4DXY)
?
[Raw transfer]




GOL_A_8(3MGX)
?
[Raw transfer]




19 PsiBlast_PDB 89.3433%-113 - C7 -4MM0 - ? -
7 PsiBlast_PDB 89.2933%-125 - C7 -4L77 - CINA_CITBR -
82 HHSearch 89.2031%-100 - C7 -4C9L - ? -
5 PsiBlast_PDB 89.1933%-123 - C7 -4FYZ - CINA_CITBR -
40 PsiBlast_CBE 89.1433%-112 - C7 -4MM0 - ? -
25 PsiBlast_CBE 88.9533%-120 - C7 -4FMX - CINA_CITBR -
23 PsiBlast_CBE 88.8533%-122 - C7 -1T2B - CINA_CITBR -
61 PsiBlast_CBE 88.7431%-105 - C7 -3NV6 12.2 ?
86 HHSearch 88.7131%-102 * C7 *4MM0 - ? -
24 PsiBlast_CBE 88.6833%-123 - C7 -4FYZ - CINA_CITBR -
2 PsiBlast_PDB 88.6333%-121 - C7 -4LHT - CINA_CITBR -
29 PsiBlast_CBE 88.5333%-126 - C7 -4L77 - CINA_CITBR -
6 PsiBlast_PDB 88.4533%-122 - C7 -4FMX - CINA_CITBR -
35 PsiBlast_CBE 88.4233%-107 - C7 -3LXI - ? -
31 PsiBlast_CBE 88.4033%-123 - C7 -3BDZ - CINA_CITBR -
33 PsiBlast_CBE 88.3733%-107 - C7 -4C9L - ? -
3 PsiBlast_PDB 88.3433%-121 - C7 -1T2B - CINA_CITBR -
36 PsiBlast_CBE 88.2733%-108 - C7 -3LXH - ? -
12 PsiBlast_PDB 88.2433%-104 - C7 -3LXI - ? -
38 PsiBlast_CBE 88.2232%-108 - C7 -4C9N - ? -
62 PsiBlast_CBE 88.0131%-109 - C7 -3NV5 12.1 ?
63 PsiBlast_CBE 87.0731%-104 - C7 -4DXY 11.9 ?