@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1847: (2016-05-05 )
MQPSPDSPAPLNVTVPFDSELGLQFTELGPDGARAQLDVRPKLLQLTGVVHGGVYCAMIESIASMAAFAWLNSHGEGGSVVGVNNNTDFVRSISSGMVYGTAEPLHRGRRQQLWLVTITDDTDRVVARGQVRLQNLEARP

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_8(3S4K)
Y1847_MYCTU
[Raw transfer]




5NE_A_2(5HMC)
?
[Raw transfer]




EDO_B_9(3S4K)
Y1847_MYCTU
[Raw transfer]




1 PsiBlast_PDB 93.01100%-110 - C1 -3S4K - Y1847_MYCTU -
21 PsiBlast_CBE 92.85100%-105 - C1 -3S4K 2.9 Y1847_MYCTU
67 HHSearch 92.30100%-110 - C1 -3S4K 2.8 Y1847_MYCTU
30 PsiBlast_CBE 75.1832%-107 - C1 -3R32 - 4HBT_ARTSP -
4 PsiBlast_PDB 75.1734%-105 - C1 -3R3D - 4HBT_ARTSP -
11 PsiBlast_PDB 75.0332%-111 - C1 -3R35 - 4HBT_ARTSP -
22 PsiBlast_CBE 74.6734%-108 - C1 -3R3D - 4HBT_ARTSP -
9 PsiBlast_PDB 74.5232%-110 - C1 -3R37 - 4HBT_ARTSP -
33 PsiBlast_CBE 74.3931%-109 - C1 -3TEA - 4HBT_ARTSP -
12 PsiBlast_PDB 74.3232%-107 - C1 -3R32 - 4HBT_ARTSP -
24 PsiBlast_CBE 74.2933%-110 - C1 -1Q4T - 4HBT_ARTSP -
32 PsiBlast_CBE 74.2732%-110 - C1 -3R3A - 4HBT_ARTSP -
31 PsiBlast_CBE 74.2332%-109 - C1 -3R3B - 4HBT_ARTSP -
55 PsiBlast_CBE 74.1033%-107 - C1 -3R3F - 4HBT_ARTSP -
15 PsiBlast_PDB 73.9431%-106 - C1 -3TEA - 4HBT_ARTSP -
23 PsiBlast_CBE 73.6833%-108 - C1 -1Q4U - 4HBT_ARTSP -
14 PsiBlast_PDB 73.6732%-106 - C1 -3R3B - 4HBT_ARTSP -
16 PsiBlast_PDB 73.6232%-104 - C1 -3R3C - 4HBT_ARTSP -
6 PsiBlast_PDB 73.5233%-109 - C1 -1Q4T - 4HBT_ARTSP -
7 PsiBlast_PDB 73.4633%-106 - C1 -1Q4U - 4HBT_ARTSP -
3 PsiBlast_PDB 71.5150% -99 - C1 -5HMC 3.0 ?