@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1869c: (2016-05-05 )
MASSTTFVIVGGGLAGAKAVEALRRSDFGGRIILFGDEEHLPYDRPPLSKEFLAGKKSLSDFTIQTSDWYRDHDVDVRLGVRVSSLDRSAHTVELPDGAAVRYDKLLLATGSAPRRPPIPGSDAAGVHYLRSYNDAVALNSVLVQGSSLAVVGAGWIGLEVAASARQRGVDVTVVETAIQPLLAALGEAVGKVFADLHRDQGVDLRLQTQLEEITAADGKATGLKMRDGSTVAADAVLVAVGAKPNVELAQQAGLAMGEGGVLVDASLRTSDPDIYAVGDIAAAEHPLLGTRVRTEHWANALKQPAVAAAGMLGRPGEYAELPYLFTDQYDLGMEYVGHAPSCDRVVFRGNVAGREFLSFWLDGDSRVLAGMNVNVWDVVDDVKGLIRSGNPVDVDRLVDPQWPLADLTTN

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_C_3(1Q1R)
CAMA_PSEPU
[Raw transfer]




FAD_D_4(1Q1R)
CAMA_PSEPU
[Raw transfer]




FAD_C_3(1Q1R)
CAMA_PSEPU
[Raw transfer]




FAD_A_2(4EMI)
TODA_PSEP1
[Raw transfer]




FAD_A_2(3EF6)
TODA_PSEP1
[Raw transfer]




FAD_C_3(1Q1W)
CAMA_PSEPU
[Raw transfer]




FAD_A_2(3EF6)
TODA_PSEP1
[Raw transfer]




FAD_A_3(4EMJ)
TODA_PSEP1
[Raw transfer]




FAD_D_4(1Q1W)
CAMA_PSEPU
[Raw transfer]




FAD_A_2(4H4Z)
?
[Raw transfer]




FAD_C_3(1D7Y)
?
[Raw transfer]




FAD_A_5(3LB8)
CAMA_PSEPU
[Raw transfer]




FAD_A_2(4H4P)
?
[Raw transfer]




FAD_A_5(2YVJ)
?
[Raw transfer]




FAD_A_2(2GQW)
?
[Raw transfer]




FAD_B_6(3LB8)
CAMA_PSEPU
[Raw transfer]




FAD_A_2(2GR0)
?
[Raw transfer]




FAD_A_2(4H4R)
?
[Raw transfer]




FAD_A_2(2GQW)
?
[Raw transfer]




FAD_A_2(4H4V)
?
[Raw transfer]




FAD_A_2(4H4T)
?
[Raw transfer]




FAD_A_2(2GR2)
?
[Raw transfer]




FAD_A_2(4H4X)
?
[Raw transfer]




FAD_P_6(2YVJ)
?
[Raw transfer]




FAD_A_2(2GR3)
?
[Raw transfer]




FAD_C_3(1D7Y)
?
[Raw transfer]




FAD_A_2(4H4Y)
?
[Raw transfer]




FAD_A_3(4H4U)
?
[Raw transfer]




FAD_A_4(4H4S)
?
[Raw transfer]




FAD_A_2(2YVF)
?
[Raw transfer]




FAD_P_2(3FG2)
?
[Raw transfer]




FAD_A_2(4H50)
?
[Raw transfer]




FAD_B_2(1F3P)
?
[Raw transfer]




FAD_P_2(3FG2)
?
[Raw transfer]




FAD_A_2(4H4W)
?
[Raw transfer]




FAD_A_7(4H4Q)
?
[Raw transfer]




FAD_A_2(2YVG)
?
[Raw transfer]




FAD_A_2(2GR1)
?
[Raw transfer]




ADP_A_3(2GR0)
?
[Raw transfer]




2 PsiBlast_PDB 96.1336%-110 - C1 -1Q1R 12.0 CAMA_PSEPU
22 PsiBlast_CBE 96.0636%-109 - C1 -1Q1R 12.0 CAMA_PSEPU
4 PsiBlast_PDB 96.0036%-111 - C1 -3LB8 12.4 CAMA_PSEPU
21 PsiBlast_CBE 94.7636%-110 - C1 -1Q1W 12.9 CAMA_PSEPU
3 PsiBlast_PDB 94.0936%-109 - C1 -1Q1W 11.8 CAMA_PSEPU
17 PsiBlast_PDB 93.1138%-107 - C1 -4H4P 13.9 ?
13 PsiBlast_PDB 93.0838%-106 - C1 -2YVF 13.9 ?
10 PsiBlast_PDB 92.9838%-108 - C1 -2GR0 11.8 ?
16 PsiBlast_PDB 92.9538%-106 - C1 -4H4Q 13.8 ?
14 PsiBlast_PDB 92.9038%-107 - C1 -2YVG 13.6 ?
23 PsiBlast_CBE 92.8236%-110 - C1 -3LB8 9.5 CAMA_PSEPU
20 PsiBlast_PDB 92.7238%-108 - C1 -4H4S 14.4 ?
25 PsiBlast_CBE 92.4638%-107 - C1 -4H4R 11.8 ?
9 PsiBlast_PDB 92.4038%-106 - C1 -2GQW 13.7 ?
27 PsiBlast_CBE 92.3137%-107 - C1 -4H4Z 13.7 ?
11 PsiBlast_PDB 91.8638%-106 - C1 -2GR1 13.9 ?
69 HHSearch 91.8136%-105 - C1 -1Q1R 12.0 CAMA_PSEPU
28 PsiBlast_CBE 91.8037%-106 - C1 -4H4Y 13.9 ?
12 PsiBlast_PDB 91.7138%-107 - C1 -2GR2 11.9 ?
26 PsiBlast_CBE 91.6937%-107 - C1 -4H50 13.8 ?
71 HHSearch 91.1637%-100 - C1 -2GQW 13.7 ?
29 PsiBlast_CBE 91.0837%-106 - C1 -4H4X 11.8 ?
19 PsiBlast_PDB 91.0438%-106 - C1 -4H4T 11.7 ?
30 PsiBlast_CBE 90.8737%-107 - C1 -4H4W 13.9 ?
6 PsiBlast_PDB 90.8238%-105 * C1 *2GR3 13.7 ?
18 PsiBlast_PDB 90.8138%-106 - C1 -4H4U 13.6 ?
31 PsiBlast_CBE 90.6737%-106 - C1 -4H4V 11.8 ?
24 PsiBlast_CBE 89.0738%-105 - C1 -2YVJ 12.8 ?
8 PsiBlast_PDB 88.4938%-102 - C1 -1F3P 12.9 ?
7 PsiBlast_PDB 87.0238% -98 - C1 -1D7Y 13.7 ?
15 PsiBlast_PDB 86.8438%-103 - C1 -2YVJ 12.2 ?
74 HHSearch 86.3632%-101 - C1 -3FG2 10.9 ?
59 Fugue 83.1636% -92 - C1 -1D7Y 13.7 ?
70 HHSearch 82.2333% -97 - C1 -3EF6 13.1 TODA_PSEP1
5 PsiBlast_PDB 80.8635%-104 - C1 -3FG2 10.9 ?
32 PsiBlast_CBE 72.7936% -97 - C1 -4EMJ 12.6 TODA_PSEP1
33 PsiBlast_CBE 72.2536% -97 - C1 -4EMI 12.2 TODA_PSEP1
34 PsiBlast_CBE 72.2336% -97 - C1 -3EF6 13.1 TODA_PSEP1