@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1876: (2016-05-05 )
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IMD_A_12(3FVB)
?
[Raw transfer]




22 PsiBlast_CBE 97.80100% -72 - C2 -3QB9 - BFR_MYCTU -
21 PsiBlast_CBE 97.48100% -70 - C2 -3QB9 - BFR_MYCTU -
1 PsiBlast_PDB 96.94100% -69 - C2 -3QB9 - BFR_MYCTU -
25 PsiBlast_CBE 96.70100% -69 - C2 -3QB9 - BFR_MYCTU -
23 PsiBlast_CBE 96.23100% -70 - C2 -3QB9 - BFR_MYCTU -
24 PsiBlast_CBE 95.98100% -71 - C2 -3QB9 - BFR_MYCTU -
26 PsiBlast_CBE 95.68100% -67 - C2 -3UOI - BFR_MYCTU -
3 PsiBlast_PDB 95.68100% -67 - C2 -3UOI - BFR_MYCTU -
260 HHSearch 95.05100% -66 - C2 -3UOI - BFR_MYCTU -
50 PsiBlast_CBE 94.02100% -69 - C2 -3UOF - BFR_MYCTU -
27 PsiBlast_CBE 94.00100% -64 - C2 -3UOI - BFR_MYCTU -
4 PsiBlast_PDB 93.7897% -68 - C2 -2WTL - BFR_MYCTU -
2 PsiBlast_PDB 92.92100% -67 - C2 -3UOF - BFR_MYCTU -
51 PsiBlast_CBE 92.59100% -61 - C2 -3UOF - BFR_MYCTU -
53 PsiBlast_CBE 92.13100% -66 - C2 -3UOF - BFR_MYCTU -
49 PsiBlast_CBE 91.80100% -70 - C2 -3UOF - BFR_MYCTU -
52 PsiBlast_CBE 89.88100% -64 - C2 -3UOF - BFR_MYCTU -
57 PsiBlast_CBE 89.5487% -68 - C2 -3BKN - ? -
56 PsiBlast_CBE 88.7987% -66 - C2 -3BKN - ? -
5 PsiBlast_PDB 88.5487% -66 - C2 -3BKN - ? -
272 HHSearch 69.0146% -53 - C2 -3FVB 3.3 ?