@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1880c: (2016-05-05 )
MKDKLHWLAMHGVIRGIAAIGIRRGDLQARLIADPAVATDPVPFYDEVRSHGALVRNRANYLTVDHRLAHDLLRSDDFRVVSFGENLPPPLRWLERRTRGDQLHPLREPSLLAVEPPDHTRYRKTVSAVFTSRAVSALRDLVEQTAINLLDRFAEQPGIVDVVGRYCSQLPIVVISEILGVPEHDRPRVLEFGELAAPSLDIGIPWRQYLRVQQGIRGFDCWLEGHLQQLRHAPGDDLMSQLIQIAESGDNETQLDETELRAIAGLVLVAGFETTVNLLGNGIRMLLDTPEHLATLRQHPELWPNTVEEILRLDSPVQLTARVACRDVEVAGVRIKRGEVVVIYLAAANRDPAVFPDPHRFDIERPNAGRHLAFSTGRHFCLGAALARAEGEVGLRTFFDRFPDVRAAGAGSRRDTRVLRGWSTLPVTLGPARSMVSP

Atome Classification :

(62 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_A_2(4RM4)
YJIB_BACSU
[Raw transfer]




HEM_A_3(2VZM)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2C6H)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2BVJ)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(2VZM)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(4UMZ)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(2C7X)
PIKC_STRVZ
[Raw transfer]




HEM_B_16(3ZPI)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(4UMZ)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(4B7S)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(3ZK5)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(2VZ7)
PIKC_STRVZ
[Raw transfer]




HEM_B_6(2BVJ)
PIKC_STRVZ
[Raw transfer]




HEM_B_9(2C6H)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(3ZPI)
PIKC_STRVZ
[Raw transfer]




HEM_B_17(4B7S)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(3ZPI)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(3A4G)
CPVDH_PSEAH
[Raw transfer]




HEM_A_3(2VZ7)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2CD8)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2WI9)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(4GGV)
?
[Raw transfer]




HEM_A_2(3A4H)
CPVDH_PSEAH
[Raw transfer]




HEM_A_2(3A4G)
CPVDH_PSEAH
[Raw transfer]




HEM_B_5(2CD8)
PIKC_STRVZ
[Raw transfer]




HEM_C_21(3R9B)
?
[Raw transfer]




HEM_B_5(3ZK5)
PIKC_STRVZ
[Raw transfer]




HEM_B_11(3R9B)
?
[Raw transfer]




HEM_A_2(1JIO)
CPXJ_SACEN
[Raw transfer]




HEM_B_5(2CA0)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(1Z8P)
CPXJ_SACEN
[Raw transfer]




HEM_A_4(4WPZ)
?
[Raw transfer]




HEM_A_3(2CA0)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2WHW)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(2WI9)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(2YCA)
MYCG_MICGR
[Raw transfer]




HEM_A_2(3R9C)
?
[Raw transfer]




HEM_A_2(1JIP)
CPXJ_SACEN
[Raw transfer]




HEM_A_2(1Z8Q)
CPXJ_SACEN
[Raw transfer]




HEM_A_2(1JIN)
CPXJ_SACEN
[Raw transfer]




HEM_B_10(3ZSN)
MYCG_MICGR
[Raw transfer]




HEM_A_2(2Y98)
MYCG_MICGR
[Raw transfer]




HEM_A_2(4WQ0)
?
[Raw transfer]




HEM_C_16(3ZSN)
MYCG_MICGR
[Raw transfer]




HEM_A_4(3R9B)
?
[Raw transfer]




HEM_B_7(4B7D)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(1Z8O)
CPXJ_SACEN
[Raw transfer]




HEM_A_2(1OXA)
CPXJ_SACEN
[Raw transfer]




HEM_A_4(3ZSN)
MYCG_MICGR
[Raw transfer]




HEM_B_5(2WHW)
PIKC_STRVZ
[Raw transfer]




HEM_A_4(4B7D)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(4UBS)
CYP28_STRAW
[Raw transfer]




HEM_A_2(1EUP)
CPXJ_SACEN
[Raw transfer]




HEM_A_2(1EGY)
CPXJ_SACEN
[Raw transfer]




HEM_A_2(1JIP)
CPXJ_SACEN
[Raw transfer]




HEM_A_2(3VRM)
CPVDH_PSEAH
[Raw transfer]




HEM_B_11(2Y5Z)
MYCG_MICGR
[Raw transfer]




HEM_C_18(2Y5Z)
MYCG_MICGR
[Raw transfer]




FMT_A_4(3ZPI)
PIKC_STRVZ
[Raw transfer]




GOL_A_8(3MGX)
?
[Raw transfer]




D12_A_14(3R9B)
?
[Raw transfer]




EDO_C_26(3R9B)
?
[Raw transfer]




140 HHSearch 92.4335% -99 * C7 *3ZPI 12.9 PIKC_STRVZ
53 PsiBlast_CBE 92.3934%-102 - C7 -2BVJ 13.2 PIKC_STRVZ
76 PsiBlast_CBE 92.2834% -95 - C7 -3ZPI 12.9 PIKC_STRVZ
70 PsiBlast_CBE 92.0234% -96 - C7 -4BF4 - PIKC_STRVZ -
68 PsiBlast_CBE 91.9234% -97 - C7 -4BF4 - PIKC_STRVZ -
139 HHSearch 91.6734%-104 - C7 -3A4G 12.5 CPVDH_PSEAH
84 PsiBlast_CBE 91.6434% -98 - C7 -2WI9 13.5 PIKC_STRVZ
66 PsiBlast_CBE 91.6334% -98 - C7 -4BF4 - PIKC_STRVZ -
85 PsiBlast_CBE 91.6234% -97 - C7 -2WHW 13.2 PIKC_STRVZ
80 PsiBlast_CBE 91.6234% -99 - C7 -2VZM 13.2 PIKC_STRVZ
50 PsiBlast_CBE 91.5034% -95 - C7 -2C7X 13.0 PIKC_STRVZ
74 PsiBlast_CBE 91.4734% -98 - C7 -4B7S 13.2 PIKC_STRVZ
83 PsiBlast_CBE 91.4634% -98 - C7 -2WI9 13.2 PIKC_STRVZ
75 PsiBlast_CBE 91.4034% -97 - C7 -3ZPI 12.9 PIKC_STRVZ
71 PsiBlast_CBE 91.3834% -97 - C7 -4BF4 - PIKC_STRVZ -
77 PsiBlast_CBE 91.3734% -98 - C7 -3ZK5 12.9 PIKC_STRVZ
79 PsiBlast_CBE 91.3634% -98 - C7 -2VZM 13.3 PIKC_STRVZ
86 PsiBlast_CBE 91.1234% -99 - C7 -2WHW 13.2 PIKC_STRVZ
45 PsiBlast_CBE 91.0634% -97 - C7 -4B7D 12.8 PIKC_STRVZ
82 PsiBlast_CBE 91.0034% -98 - C7 -2VZ7 13.2 PIKC_STRVZ
78 PsiBlast_CBE 91.0034% -94 - C7 -3ZK5 13.1 PIKC_STRVZ
52 PsiBlast_CBE 90.9234% -97 - C7 -2C6H 13.3 PIKC_STRVZ
55 PsiBlast_CBE 90.6934% -97 - C7 -4UMZ 13.2 PIKC_STRVZ
46 PsiBlast_CBE 90.6134% -98 - C7 -2CD8 13.3 PIKC_STRVZ
54 PsiBlast_CBE 90.5334% -96 - C7 -2BVJ 13.1 PIKC_STRVZ
73 PsiBlast_CBE 90.4934% -98 - C7 -4B7S 12.8 PIKC_STRVZ
51 PsiBlast_CBE 90.4434% -95 - C7 -2C6H 12.9 PIKC_STRVZ
56 PsiBlast_CBE 90.3534% -93 - C7 -4UMZ 13.0 PIKC_STRVZ
47 PsiBlast_CBE 90.1334% -96 - C7 -2CD8 12.9 PIKC_STRVZ
81 PsiBlast_CBE 90.1134% -97 - C7 -2VZ7 12.8 PIKC_STRVZ
10 PsiBlast_PDB 89.9533% -98 - C7 -3R9C 12.4 ?
95 PsiBlast_CBE 89.6635% -90 - C7 -4UBS 12.5 CYP28_STRAW
109 Fugue 89.2835%-100 - C7 -1JIP 11.1 CPXJ_SACEN
44 PsiBlast_CBE 89.1834% -97 - C7 -4B7D 13.3 PIKC_STRVZ
2 PsiBlast_PDB 89.0344%-108 - C7 -1JIP 11.0 CPXJ_SACEN
49 PsiBlast_CBE 88.9034% -96 - C7 -2CA0 12.2 PIKC_STRVZ
3 PsiBlast_PDB 88.5644%-106 - C7 -1Z8P 11.9 CPXJ_SACEN
4 PsiBlast_PDB 88.5444%-104 - C7 -1Z8O 12.0 CPXJ_SACEN
5 PsiBlast_PDB 88.3944%-106 - C7 -1JIO 11.8 CPXJ_SACEN
8 PsiBlast_PDB 88.3843%-107 - C7 -1JIN 10.5 CPXJ_SACEN
22 PsiBlast_CBE 88.3333% -98 - C7 -3R9B 13.0 ?
1 PsiBlast_PDB 88.3244%-105 - C7 -1Z8Q 12.2 CPXJ_SACEN
21 PsiBlast_CBE 88.1533% -96 - C7 -3R9B 13.0 ?
9 PsiBlast_PDB 88.1443%-105 - C7 -1OXA 11.7 CPXJ_SACEN
15 PsiBlast_PDB 87.9640%-103 - C7 -3A4G 12.5 CPVDH_PSEAH
11 PsiBlast_PDB 87.8833% -97 - C7 -3R9B 12.9 ?
48 PsiBlast_CBE 87.4934% -91 - C7 -2CA0 12.7 PIKC_STRVZ
7 PsiBlast_PDB 86.8643%-106 - C7 -1EUP 11.7 CPXJ_SACEN
6 PsiBlast_PDB 86.8543%-106 - C7 -1EGY 11.4 CPXJ_SACEN
16 PsiBlast_PDB 85.8540%-103 - C7 -3A4H 11.9 CPVDH_PSEAH
17 PsiBlast_PDB 84.9439%-104 - C7 -3VRM 12.1 CPVDH_PSEAH
105 PsiBlast_CBE 83.9835%-106 - C7 -2YCA 12.1 MYCG_MICGR
99 PsiBlast_CBE 83.6235%-107 - C7 -3ZSN 12.2 MYCG_MICGR
87 PsiBlast_CBE 83.0333%-113 - C7 -4RM4 12.5 YJIB_BACSU
93 PsiBlast_CBE 83.0235%-111 - C7 -4WPZ 12.5 ?
106 PsiBlast_CBE 82.9035%-105 - C7 -2Y98 12.1 MYCG_MICGR
107 PsiBlast_CBE 82.7035%-105 - C7 -2Y5Z 12.0 MYCG_MICGR
88 PsiBlast_CBE 82.4336%-109 - C7 -4GGV 11.8 ?
98 PsiBlast_CBE 82.1635%-104 - C7 -3ZSN 11.9 MYCG_MICGR
100 PsiBlast_CBE 81.9635%-105 - C7 -3ZSN 11.9 MYCG_MICGR
94 PsiBlast_CBE 81.9335%-109 - C7 -4WQ0 12.3 ?
108 PsiBlast_CBE 81.8735%-108 - C7 -2Y5Z 12.0 MYCG_MICGR