@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1886c: (2016-05-05 )
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_15(3HRH)
A85C_MYCTU
[Raw transfer]




GOL_A_4(3HRH)
A85C_MYCTU
[Raw transfer]




MPD_C_3(1F0N)
A85B_MYCTU
[Raw transfer]




46 Fugue 97.04100% -80 - C2 -1F0N 2.5 A85B_MYCTU
1 PsiBlast_PDB 96.90100% -79 - C2 -1F0P - A85B_MYCTU -
2 PsiBlast_PDB 96.65100% -81 - C2 -1F0N - A85B_MYCTU -
24 HHSearch 89.3382% -79 - C2 -1SFR - A85A_MYCTU -
22 PsiBlast_CBE 88.3872% -76 - C2 -1VA5 - A85C_MYCTU -
47 Fugue 88.3472% -77 - C2 -1DQZ - A85C_MYCTU -
14 PsiBlast_PDB 88.0272% -79 - C2 -4MQL - A85C_MYCTU -
16 PsiBlast_PDB 87.9172% -78 - C2 -1DQZ - A85C_MYCTU -
8 PsiBlast_PDB 87.5372% -73 - C2 -1VA5 - A85C_MYCTU -
10 PsiBlast_PDB 87.2572% -76 - C2 -1DQY - A85C_MYCTU -
15 PsiBlast_PDB 87.2472% -84 - C2 -4QDX - A85C_MYCTU -
5 PsiBlast_PDB 87.1572% -79 - C2 -4QEK - A85C_MYCTU -
9 PsiBlast_PDB 87.0872% -89 - C2 -4QE3 - A85C_MYCTU -
21 PsiBlast_CBE 86.9272% -79 - C2 -3HRH 3.4 A85C_MYCTU
4 PsiBlast_PDB 86.6772% -88 - C2 -4MQM - A85C_MYCTU -
11 PsiBlast_PDB 86.3872% -81 - C2 -4QDT - A85C_MYCTU -
6 PsiBlast_PDB 86.2572% -86 - C2 -4QDZ - A85C_MYCTU -
25 HHSearch 85.8371% -79 - C2 -4MQL - A85C_MYCTU -
7 PsiBlast_PDB 85.7572% -77 - C2 -3HRH 3.5 A85C_MYCTU
12 PsiBlast_PDB 77.4972% -67 - C2 -4QDO - A85C_MYCTU -