@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1938: (2016-05-06 )
MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BSU_A_5(2ZJF)
?
[Raw transfer]




S0D_A_4(3WK7)
HYES_HUMAN
[Raw transfer]




W9L_A_3(4C4Z)
HYES_HUMAN
[Raw transfer]




NC3_P_4(1ZD2)
HYES_HUMAN
[Raw transfer]




3C5_A_3(4Y2P)
HYES_HUMAN
[Raw transfer]




7GM_A_5(5ALM)
HYES_HUMAN
[Raw transfer]




WMR_A_5(5ALK)
HYES_HUMAN
[Raw transfer]




49N_A_3(4Y2Q)
HYES_HUMAN
[Raw transfer]




S82_A_3(3ANT)
HYES_HUMAN
[Raw transfer]




II6_A_6(5ALL)
HYES_HUMAN
[Raw transfer]




49O_A_3(4Y2R)
HYES_HUMAN
[Raw transfer]




S0C_A_4(3WK5)
HYES_HUMAN
[Raw transfer]




TGX_A_4(5AIC)
HYES_HUMAN
[Raw transfer]




6NM_A_6(5AKH)
HYES_HUMAN
[Raw transfer]




W9M_A_3(4C4X)
HYES_HUMAN
[Raw transfer]




GZP_A_4(5ALQ)
HYES_HUMAN
[Raw transfer]




K2T_A_6(5AI8)
HYES_HUMAN
[Raw transfer]




S0F_A_4(3WK9)
HYES_HUMAN
[Raw transfer]




ZYI_B_4(3PDC)
HYES_HUMAN
[Raw transfer]




KJU_A_5(5AIB)
HYES_HUMAN
[Raw transfer]




ONR_A_8(5ALE)
HYES_HUMAN
[Raw transfer]




DMS_A_5(5ALT)
HYES_HUMAN
[Raw transfer]




6NX_A_8(5AKZ)
HYES_HUMAN
[Raw transfer]




8NY_A_5(5AKX)
HYES_HUMAN
[Raw transfer]




6TZ_A_4(5ALV)
HYES_HUMAN
[Raw transfer]




S0E_A_4(3WK8)
HYES_HUMAN
[Raw transfer]




KUF_A_6(5AM2)
HYES_HUMAN
[Raw transfer]




KUF_A_7(5AM2)
HYES_HUMAN
[Raw transfer]




IPA_A_2(3G9X)
DHAA_RHOSO
[Raw transfer]




PG4_A_3(2CJP)
?
[Raw transfer]




PEG_A_4(4INZ)
?
[Raw transfer]




2 PsiBlast_PDB 92.0299%-113 - C1 -2E3J - ? -
1 PsiBlast_PDB 91.9899%-114 - C1 -2ZJF 6.3 ?
102 Fugue 60.2030%-101 * C1 *1EK1 - HYES_MOUSE -
11 PsiBlast_PDB 60.0032%-105 - C1 -1VJ5 - HYES_HUMAN -
70 PsiBlast_CBE 59.7932%-106 - C1 -5ALO - HYES_HUMAN -
69 PsiBlast_CBE 59.7632%-106 - C1 -5ALP - HYES_HUMAN -
83 PsiBlast_CBE 59.6832%-104 - C1 -5AKY - HYES_HUMAN -
27 PsiBlast_CBE 59.6532%-107 - C1 -4Y2Y - HYES_HUMAN -
80 PsiBlast_CBE 59.6432%-106 - C1 -5ALE 4.2 HYES_HUMAN
79 PsiBlast_CBE 59.6432%-106 - C1 -5ALF - HYES_HUMAN -
46 PsiBlast_CBE 59.6432%-107 - C1 -3WK8 3.9 HYES_HUMAN
100 PsiBlast_CBE 59.6332%-106 - C1 -5AI8 3.2 HYES_HUMAN
42 PsiBlast_CBE 59.6332%-108 - C1 -3WKC - HYES_HUMAN -
96 PsiBlast_CBE 59.5932%-105 - C1 -5AIC 3.5 HYES_HUMAN
99 PsiBlast_CBE 59.5032%-105 - C1 -5AI9 - HYES_HUMAN -
55 PsiBlast_CBE 59.5032%-108 - C1 -5AM4 - HYES_HUMAN -
54 PsiBlast_CBE 59.4632%-105 - C1 -5AM5 - HYES_HUMAN -
48 PsiBlast_CBE 59.3832%-108 - C1 -3WK6 - HYES_HUMAN -
44 PsiBlast_CBE 59.3832%-107 - C1 -3WKA - HYES_HUMAN -
10 PsiBlast_PDB 59.3632%-102 - C1 -1S8O - HYES_HUMAN -
82 PsiBlast_CBE 59.2632%-106 - C1 -5AKZ 3.1 HYES_HUMAN
68 PsiBlast_CBE 59.2332%-106 - C1 -5ALQ 5.0 HYES_HUMAN
45 PsiBlast_CBE 59.1732%-104 - C1 -3WK9 3.6 HYES_HUMAN
34 PsiBlast_CBE 59.1532%-104 - C1 -4Y2Q 3.9 HYES_HUMAN
89 PsiBlast_CBE 59.0932%-105 - C1 -5AKH 5.9 HYES_HUMAN
84 PsiBlast_CBE 59.0432%-106 - C1 -5AKX 3.4 HYES_HUMAN
47 PsiBlast_CBE 59.0432%-105 - C1 -3WK7 4.0 HYES_HUMAN
66 PsiBlast_CBE 59.0132%-106 - C1 -5ALT 3.6 HYES_HUMAN
33 PsiBlast_CBE 58.9632%-105 - C1 -4Y2R 3.2 HYES_HUMAN
9 PsiBlast_PDB 58.8832%-107 - C1 -4C4Z 4.5 HYES_HUMAN
74 PsiBlast_CBE 58.7232%-105 - C1 -5ALK 5.3 HYES_HUMAN
4 PsiBlast_PDB 58.6432%-108 - C1 -3ANT 7.2 HYES_HUMAN
73 PsiBlast_CBE 58.6332%-105 - C1 -5ALL 3.7 HYES_HUMAN
49 PsiBlast_CBE 58.5232%-106 - C1 -3WK5 4.1 HYES_HUMAN
51 PsiBlast_CBE 58.4332%-103 - C1 -3PDC 5.4 HYES_HUMAN
97 PsiBlast_CBE 58.3932%-106 - C1 -5AIB 3.4 HYES_HUMAN
72 PsiBlast_CBE 58.3032%-105 - C1 -5ALM 4.6 HYES_HUMAN
35 PsiBlast_CBE 58.2432%-105 - C1 -4Y2P 4.9 HYES_HUMAN
7 PsiBlast_PDB 58.0632%-104 - C1 -4C4X 4.4 HYES_HUMAN
12 PsiBlast_PDB 57.7332%-103 - C1 -1ZD2 3.5 HYES_HUMAN
57 PsiBlast_CBE 57.5032%-105 - C1 -5AM2 3.9 HYES_HUMAN
64 PsiBlast_CBE 57.4732%-107 - C1 -5ALV 2.3 HYES_HUMAN
123 HHSearch 36.4843%-120 - C1 -2CJP 1.8 ?
112 HHSearch 35.1635%-122 - C1 -4INZ 2.8 ?
120 HHSearch 34.4231%-121 - C1 -3G9X 3.8 DHAA_RHOSO