@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2110c: (2016-05-07 )
MTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTIVALKYPGGVVMAGDRRSTQGNMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPLLAGYDIHASDPQSAGRIVSFDAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGGPDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SA6_Z_(3MI0)
?
[Raw transfer]




45 PsiBlast_CBE 96.77100%-104 - C8 -3HFA - PSB_MYCTU -
5 PsiBlast_PDB 96.66100%-105 - C8 -3HFA - PSB_MYCTU -
11 PsiBlast_PDB 96.33100% -99 - C8 -3HF9 - PSB_MYCTU -
49 PsiBlast_CBE 96.28100%-106 - C8 -3HFA - PSB_MYCTU -
4 PsiBlast_PDB 96.06100% -99 - C8 -2FHH - PSB_MYCTU -
21 PsiBlast_CBE 96.04100%-102 - C8 -3MI0 3.7 ?
6 PsiBlast_PDB 96.02100%-100 - C8 -3MFE - ? -
8 PsiBlast_PDB 95.90100%-101 - C8 -3KRD - PSB_MYCTU -
7 PsiBlast_PDB 95.86100%-106 - C8 -3MI0 - ? -
56 PsiBlast_CBE 95.44100% -99 - C8 -2FHH - PSB_MYCTU -
3 PsiBlast_PDB 95.36100% -99 - C8 -2FHG - PSB_MYCTU -
33 PsiBlast_CBE 94.94100%-100 - C8 -3KRD - PSB_MYCTU -
1 PsiBlast_PDB 92.53100%-116 - C8 -2JAY - PSB_MYCTU -
127 HHSearch 92.2099%-117 - C8 -2JAY - PSB_MYCTU -
14 PsiBlast_PDB 84.4267% -90 - C8 -1Q5Q - PSB1_RHOER -
68 PsiBlast_CBE 75.04100% -33 - C8 -3H6I - PSB_MYCTU -
80 PsiBlast_CBE 74.37100% -31 - C8 -3H6F - PSB_MYCTU -
10 PsiBlast_PDB 74.17100% -30 - C8 -3H6I - PSB_MYCTU -
9 PsiBlast_PDB 73.94100% -30 - C8 -3H6F - PSB_MYCTU -
72 PsiBlast_CBE 73.27100% -31 - C8 -3H6I - PSB_MYCTU -