@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2118c: (2016-05-07 )
MSATGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVAPAPLGRKREGRDG

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAM_B_2(1I9G)
TRMI_MYCTU
[Raw transfer]




SAM_B_2(1I9G)
TRMI_MYCTU
[Raw transfer]




SAM_B_2(1I9G)
TRMI_MYCTU
[Raw transfer]




SAM_A_2(3MB5)
TRMI_PYRAB
[Raw transfer]




SAH_C_9(3LGA)
TRMI_PYRAB
[Raw transfer]




SAH_D_11(3LGA)
TRMI_PYRAB
[Raw transfer]




SAH_A_5(3LGA)
TRMI_PYRAB
[Raw transfer]




SAH_B_7(3LGA)
TRMI_PYRAB
[Raw transfer]




SAM_A_2(3MB5)
TRMI_PYRAB
[Raw transfer]




SAH_A_6(2PWY)
TRMI_THET2
[Raw transfer]




SAH_A_6(2PWY)
TRMI_THET2
[Raw transfer]




SAH_A_6(2PWY)
TRMI_THET2
[Raw transfer]




SAH_D_8(3LHD)
TRMI_PYRAB
[Raw transfer]




SAH_C_5(3LHD)
TRMI_PYRAB
[Raw transfer]




SAH_A_6(3LHD)
TRMI_PYRAB
[Raw transfer]




EDO_A_12(3MB5)
TRMI_PYRAB
[Raw transfer]




SAH_B_7(3LHD)
TRMI_PYRAB
[Raw transfer]




EDO_A_9(3MB5)
TRMI_PYRAB
[Raw transfer]




SAM_F_6(5C0O)
TRMI_THET2
[Raw transfer]




51 HHSearch 99.61100%-131 - C1 -1I9G 9.2 TRMI_MYCTU
41 Fugue 99.61100%-131 - C1 -1I9G 9.2 TRMI_MYCTU
1 PsiBlast_PDB 99.61100%-131 - C1 -1I9G 9.2 TRMI_MYCTU
5 PsiBlast_PDB 72.0740%-108 - C1 -2PWY 7.5 TRMI_THET2
27 PsiBlast_CBE 72.0040%-111 - C1 -2PWY 7.3 TRMI_THET2
55 HHSearch 71.4534%-115 - C1 -2B25 - TR61B_HUMAN -
53 HHSearch 70.8638%-101 - C1 -2PWY 7.5 TRMI_THET2
29 PsiBlast_CBE 70.8339%-114 - C1 -5C1I - TRMI_THET2 -
3 PsiBlast_PDB 70.7835%-116 - C1 -3LGA 7.0 TRMI_PYRAB
50 HHSearch 70.6829%-114 - C1 -1O54 - ? -
24 PsiBlast_CBE 70.5435%-115 - C1 -3LGA 6.6 TRMI_PYRAB
21 PsiBlast_CBE 70.3635%-112 - C1 -3LHD 6.0 TRMI_PYRAB
26 PsiBlast_CBE 70.1535%-114 - C1 -3LGA 6.5 TRMI_PYRAB
2 PsiBlast_PDB 70.1235%-111 - C1 -3LHD 5.1 TRMI_PYRAB
25 PsiBlast_CBE 69.9835%-115 - C1 -3LGA 6.7 TRMI_PYRAB
22 PsiBlast_CBE 69.7835%-112 - C1 -3LHD 5.2 TRMI_PYRAB
7 PsiBlast_PDB 69.5429%-114 - C1 -1O54 - ? -
4 PsiBlast_PDB 69.5235%-109 - C1 -3MB5 8.4 TRMI_PYRAB
23 PsiBlast_CBE 68.9535%-111 - C1 -3LHD 4.2 TRMI_PYRAB
9 PsiBlast_PDB 68.8729%-123 - C1 -2YVL - ? -
56 HHSearch 68.5836%-105 - C1 -3MB5 8.4 TRMI_PYRAB
32 PsiBlast_CBE 66.3339%-125 - C1 -5C0O 2.6 TRMI_THET2