@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2139: (2016-05-08 )
MYPLVRRLLFLIPPEHAHKLVFAVLRGVAAVAPVRRLLRRLLGPTDPVLASTVFGVRFPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPGNPAPRLFRLADDRALLNRMGFNNHGARALAIRLARHRPEIPIGVNIGKTKKTPAGDAVNDYRASARMVGPLASYLVVNVSSPNTPGLRDLQAVESLRPILSAVRAETSTPVLVKIAPDLSDSDLDDIADLAVELDLAGIVATNTTVSRDGLTTPGVDRLGPGGISGPPLAQRAVQVLRRLYDRVGDRLALISVGGIETADDAWERITAGASLLQGYTGFIYGGERWAKDIHEGIARRLHDGGFGSLHEAVGSARRRQPS

Atome Classification :

(64 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_3(4XQ6)
PYRD_MYCTU
[Raw transfer]




FMN_A_3(4XQ6)
PYRD_MYCTU
[Raw transfer]




FMN_H_8(2FPY)
PYRD_HUMAN
[Raw transfer]




FMN_B_7(4XQ6)
PYRD_MYCTU
[Raw transfer]




FMN_A_3(4CQ8)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(4CQ9)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(5DEL)
PYRD_PLAF7
[Raw transfer]




FMN_B_6(4CQ8)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4RR4)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4OQV)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(2PRL)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4ORM)
PYRD_PLAF7
[Raw transfer]




FMN_A_4(1TV5)
PYRD_PLAF7
[Raw transfer]




FMN_B_6(4CQA)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(4RX0)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4OQV)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4CQ8)
PYRD_PLAF7
[Raw transfer]




FMN_C_3(2B0M)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVM)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4IGH)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3G0U)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3ZWT)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(2PRH)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4LS2)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(1UUO)
PYRD_RAT
[Raw transfer]




FMN_A_2(3FJL)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4CQA)
PYRD_PLAF7
[Raw transfer]




FMN_A_8(2FPV)
PYRD_HUMAN
[Raw transfer]




FMN_B_6(4CQ9)
PYRD_PLAF7
[Raw transfer]




FMN_A_4(2BXV)
PYRD_HUMAN
[Raw transfer]




FMN_A_7(2FPT)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3I6R)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3I65)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3I68)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(3F1Q)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3O8A)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4JTS)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(2PRM)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3U2O)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVJ)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3FJ6)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVL)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4RK8)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4RKA)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JS3)
PYRD_HUMAN
[Raw transfer]




FMN_A_7(2FQI)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVK)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3ZWS)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4LS0)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4RLI)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(2WV8)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3SFK)
PYRD_PLAF7
[Raw transfer]




FMN_A_5(1D3G)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(1D3H)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JTT)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4LS1)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JTU)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JGD)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3G0X)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(1D3G)
PYRD_HUMAN
[Raw transfer]




FMN_A_10(3W7R)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4ORI)
PYRD_RAT
[Raw transfer]




FMN_B_7(1UUM)
PYRD_RAT
[Raw transfer]




FMN_A_3(1UUM)
PYRD_RAT
[Raw transfer]




AFI_B_9(1UUM)
PYRD_RAT
[Raw transfer]




AFI_A_5(1UUM)
PYRD_RAT
[Raw transfer]




ACY_A_14(4JS3)
PYRD_HUMAN
[Raw transfer]




DET_A_4(4JGD)
PYRD_HUMAN
[Raw transfer]




DET_A_5(3KVK)
PYRD_HUMAN
[Raw transfer]




2V6_A_4(4ORI)
PYRD_RAT
[Raw transfer]




88 HHSearch 94.94100%-102 - C2 -4XQ6 10.5 PYRD_MYCTU
21 PsiBlast_CBE 94.8298%-102 - C2 -4XQ6 10.3 PYRD_MYCTU
1 PsiBlast_PDB 94.5598%-102 - C2 -4XQ6 10.5 PYRD_MYCTU
42 PsiBlast_CBE 77.3843% -85 - C2 -3KVK 10.1 PYRD_HUMAN
47 PsiBlast_CBE 77.2043% -84 - C2 -2FPT 9.8 PYRD_HUMAN
44 PsiBlast_CBE 77.0543% -85 - C2 -2FQI 10.0 PYRD_HUMAN
28 PsiBlast_CBE 76.9943% -86 - C2 -4RLI 9.7 PYRD_HUMAN
38 PsiBlast_CBE 76.9643% -85 - C2 -4JGD 10.8 PYRD_HUMAN
11 PsiBlast_PDB 76.9343% -85 - C2 -1D3H 10.1 PYRD_HUMAN
18 PsiBlast_PDB 76.8743% -83 - C2 -3FJL 10.9 PYRD_HUMAN
105 Fugue 76.8141% -93 - C2 -1D3G 11.0 PYRD_HUMAN
40 PsiBlast_CBE 76.6543% -84 - C2 -3KVM 10.7 PYRD_HUMAN
43 PsiBlast_CBE 76.6443% -84 - C2 -3KVJ 10.9 PYRD_HUMAN
34 PsiBlast_CBE 76.4843% -84 - C2 -4JTU 11.0 PYRD_HUMAN
17 PsiBlast_PDB 76.3743% -84 - C2 -3FJ6 10.6 PYRD_HUMAN
23 PsiBlast_CBE 76.3643% -84 - C2 -3ZWT 10.8 PYRD_HUMAN
16 PsiBlast_PDB 76.3343% -83 - C2 -3F1Q 10.8 PYRD_HUMAN
39 PsiBlast_CBE 76.2743% -81 - C2 -3W7R 10.8 PYRD_HUMAN
25 PsiBlast_CBE 76.2543% -83 - C2 -2B0M 9.3 PYRD_HUMAN
20 PsiBlast_PDB 76.2043% -85 - C2 -3G0X 10.3 PYRD_HUMAN
19 PsiBlast_PDB 76.1743% -83 - C2 -3G0U 10.5 PYRD_HUMAN
14 PsiBlast_PDB 76.1743% -84 - C2 -2PRL 10.9 PYRD_HUMAN
8 PsiBlast_PDB 76.1743% -85 - C2 -3U2O 10.5 PYRD_HUMAN
36 PsiBlast_CBE 76.1643% -84 - C2 -4JTS 10.6 PYRD_HUMAN
41 PsiBlast_CBE 76.0843% -83 - C2 -3KVL 11.0 PYRD_HUMAN
24 PsiBlast_CBE 76.0443% -83 - C2 -3ZWS 10.6 PYRD_HUMAN
32 PsiBlast_CBE 76.0343% -82 - C2 -4LS1 10.3 PYRD_HUMAN
35 PsiBlast_CBE 75.9843% -84 - C2 -4JTT 10.7 PYRD_HUMAN
27 PsiBlast_CBE 75.8043% -84 - C2 -4RR4 10.2 PYRD_HUMAN
33 PsiBlast_CBE 75.7743% -83 - C2 -4LS0 10.0 PYRD_HUMAN
37 PsiBlast_CBE 75.7243% -84 - C2 -4JS3 11.1 PYRD_HUMAN
12 PsiBlast_PDB 75.5843% -87 - C2 -2BXV 10.0 PYRD_HUMAN
15 PsiBlast_PDB 75.5243% -78 - C2 -2PRM 9.4 PYRD_HUMAN
86 HHSearch 75.4342% -95 - C2 -4OQV 11.0 PYRD_HUMAN
45 PsiBlast_CBE 75.2943% -82 - C2 -2FPY 10.0 PYRD_HUMAN
4 PsiBlast_PDB 75.2042% -93 - C2 -1UUO 8.9 PYRD_RAT
85 HHSearch 75.0933% -88 - C2 -4CQ8 9.5 PYRD_PLAF7
31 PsiBlast_CBE 75.0443% -82 - C2 -4LS2 10.6 PYRD_HUMAN
13 PsiBlast_PDB 74.9243% -90 - C2 -2PRH 10.7 PYRD_HUMAN
10 PsiBlast_PDB 74.8943% -87 - C2 -1D3G 11.1 PYRD_HUMAN
6 PsiBlast_PDB 74.8743% -92 - C2 -4OQV 11.0 PYRD_HUMAN
46 PsiBlast_CBE 74.8543% -81 - C2 -2FPV 10.0 PYRD_HUMAN
30 PsiBlast_CBE 74.7243% -82 - C2 -4RK8 10.2 PYRD_HUMAN
29 PsiBlast_CBE 74.7043% -80 - C2 -4RKA 9.9 PYRD_HUMAN
9 PsiBlast_PDB 74.5043% -80 - C2 -2WV8 9.3 PYRD_HUMAN
84 HHSearch 74.3633% -86 - C2 -1TV5 8.7 PYRD_PLAF7
7 PsiBlast_PDB 74.2243% -86 - C2 -4IGH 10.6 PYRD_HUMAN
5 PsiBlast_PDB 74.0842% -86 - C2 -4ORI 9.9 PYRD_RAT
3 PsiBlast_PDB 73.9742% -91 - C2 -1UUM 9.5 PYRD_RAT
22 PsiBlast_CBE 73.5942% -90 - C2 -1UUM 9.5 PYRD_RAT
49 PsiBlast_CBE 73.2532% -84 - C2 -5DEL 9.3 PYRD_PLAF7
51 PsiBlast_CBE 72.5732% -86 - C2 -4ORM 10.1 PYRD_PLAF7
56 PsiBlast_CBE 72.4432% -82 - C2 -4CQ8 8.8 PYRD_PLAF7
57 PsiBlast_CBE 72.3732% -84 - C2 -4CQ8 9.5 PYRD_PLAF7
53 PsiBlast_CBE 71.9332% -85 - C2 -4CQA 9.7 PYRD_PLAF7
50 PsiBlast_CBE 71.6332% -93 - C2 -4RX0 7.6 PYRD_PLAF7
55 PsiBlast_CBE 71.4932% -87 - C2 -4CQ9 9.8 PYRD_PLAF7
54 PsiBlast_CBE 71.4332% -86 - C2 -4CQ9 9.8 PYRD_PLAF7
52 PsiBlast_CBE 71.2532% -87 - C2 -4CQA 10.1 PYRD_PLAF7
63 PsiBlast_CBE 70.8432% -88 * C2 *3I65 10.3 PYRD_PLAF7
62 PsiBlast_CBE 70.5832% -81 - C2 -3I68 10.0 PYRD_PLAF7
60 PsiBlast_CBE 70.5532% -82 - C2 -3O8A 9.1 PYRD_PLAF7
61 PsiBlast_CBE 70.5332% -82 - C2 -3I6R 9.4 PYRD_PLAF7
48 PsiBlast_CBE 69.6432% -89 - C2 -3SFK 7.9 PYRD_PLAF7