@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2445c: (2016-05-10 )
MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA

Atome Classification :

(99 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_5(1WKL)
NDK_THET8
[Raw transfer]




GTP_B_5(3Q86)
NDK_STAAC
[Raw transfer]




RTP_A_7(1MN9)
NDKC_DICDI
[Raw transfer]




ADP_G_7(1ZS6)
NDK3_HUMAN
[Raw transfer]




RTP_A_7(1MN9)
NDKC_DICDI
[Raw transfer]




CIT_A_7(4ANE)
NDK_MYCTU
[Raw transfer]




ADP_C_12(1B4S)
NDKC_DICDI
[Raw transfer]




CIT_A_7(4ANE)
NDK_MYCTU
[Raw transfer]




CIT_F_9(4ANE)
NDK_MYCTU
[Raw transfer]




ATP_B_6(1WKL)
NDK_THET8
[Raw transfer]




ADP_K_11(1ZS6)
NDK3_HUMAN
[Raw transfer]




ADP_C_12(2BEF)
NDKC_DICDI
[Raw transfer]




TNV_D_16(3FKB)
NDKC_DICDI
[Raw transfer]




ADP_A_10(1B4S)
NDKC_DICDI
[Raw transfer]




D4T_C_11(1F3F)
NDKC_DICDI
[Raw transfer]




D4T_B_9(1F3F)
NDKC_DICDI
[Raw transfer]




ADP_C_12(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_A_8(1KDN)
NDKC_DICDI
[Raw transfer]




CIT_D_8(4ANE)
NDK_MYCTU
[Raw transfer]




ADP_B_10(2BEF)
NDKC_DICDI
[Raw transfer]




UDP_D_13(3Q8V)
NDK_STAAC
[Raw transfer]




RTP_A_7(1MN9)
NDKC_DICDI
[Raw transfer]




ADP_D_12(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_B_10(1KDN)
NDKC_DICDI
[Raw transfer]




GTP_A_3(3Q86)
NDK_STAAC
[Raw transfer]




ADP_D_15(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_B_9(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_C_11(3Q8U)
NDK_STAAC
[Raw transfer]




GDP_G_7(1WKK)
NDK_THET8
[Raw transfer]




D4T_A_8(1F3F)
NDKC_DICDI
[Raw transfer]




ADP_I_9(1ZS6)
NDK3_HUMAN
[Raw transfer]




ADP_A_4(1NDP)
NDKC_DICDI
[Raw transfer]




ADP_A_4(1NDP)
NDKC_DICDI
[Raw transfer]




ADP_E_14(3Q8U)
NDK_STAAC
[Raw transfer]




3AN_B_9(1HIY)
NDKC_DICDI
[Raw transfer]




ADP_A_9(2DYA)
NDK_PYRHO
[Raw transfer]




ADP_A_7(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_B_11(1B4S)
NDKC_DICDI
[Raw transfer]




TYD_A_3(1NDC)
NDKC_DICDI
[Raw transfer]




CDP_A_4(4FKX)
?
[Raw transfer]




EOI_B_8(4CP5)
NDKC_DICDI
[Raw transfer]




CDP_E_12(3Q89)
NDK_STAAC
[Raw transfer]




GDP_A_8(2DXE)
NDK_PYRHO
[Raw transfer]




EOI_A_7(4CP5)
NDKC_DICDI
[Raw transfer]




ADP_B_5(1NDP)
NDKC_DICDI
[Raw transfer]




TNM_E_20(3FKB)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2DY9)
NDK_PYRHO
[Raw transfer]




3AN_A_7(1HIY)
NDKC_DICDI
[Raw transfer]




3AN_C_11(1HIY)
NDKC_DICDI
[Raw transfer]




POP_H_8(1B99)
NDKC_DICDI
[Raw transfer]




ADP_B_10(2DYA)
NDK_PYRHO
[Raw transfer]




CDP_B_10(3Q89)
NDK_STAAC
[Raw transfer]




ADP_H_24(3Q8Y)
NDK_STAAC
[Raw transfer]




TNM_F_22(3FKB)
NDKC_DICDI
[Raw transfer]




PPS_A_4(1BUX)
NDKC_DICDI
[Raw transfer]




TNM_B_10(3FKB)
NDKC_DICDI
[Raw transfer]




EOI_E_11(4CP5)
NDKC_DICDI
[Raw transfer]




SON_H_8(1S5Z)
NDKC_DICDI
[Raw transfer]




TBD_C_9(1F6T)
NDKC_DICDI
[Raw transfer]




EOI_D_10(4CP5)
NDKC_DICDI
[Raw transfer]




ADP_F_16(3Q8U)
NDK_STAAC
[Raw transfer]




UDP_A_9(3Q8V)
NDK_STAAC
[Raw transfer]




PPS_B_5(1BUX)
NDKC_DICDI
[Raw transfer]




UDP_B_11(3Q8V)
NDK_STAAC
[Raw transfer]




TNM_A_7(3FKB)
NDKC_DICDI
[Raw transfer]




ADP_E_18(3Q8Y)
NDK_STAAC
[Raw transfer]




TBD_A_7(1F6T)
NDKC_DICDI
[Raw transfer]




AZD_A_6(1LWX)
NDKC_DICDI
[Raw transfer]




GOL_A_3(3ZTP)
NDK_AQUAE
[Raw transfer]




TNM_C_13(3FKB)
NDKC_DICDI
[Raw transfer]




AZD_B_7(1LWX)
NDKC_DICDI
[Raw transfer]




PPS_C_6(1BUX)
NDKC_DICDI
[Raw transfer]




TYD_A_3(3EVO)
NDK_MIMIV
[Raw transfer]




TBD_B_8(1F6T)
NDKC_DICDI
[Raw transfer]




AZD_C_8(1LWX)
NDKC_DICDI
[Raw transfer]




ADP_A_9(3Q8Y)
NDK_STAAC
[Raw transfer]




ANP_A_5(2DXD)
NDK_PYRHO
[Raw transfer]




EOI_F_12(4CP5)
NDKC_DICDI
[Raw transfer]




GNP_A_7(2DXF)
NDK_PYRHO
[Raw transfer]




ADP_G_22(3Q8Y)
NDK_STAAC
[Raw transfer]




POP_L_12(1B99)
NDKC_DICDI
[Raw transfer]




EOI_C_9(4CP5)
NDKC_DICDI
[Raw transfer]




CMP_R_3(1NHK)
NDK_MYXXA
[Raw transfer]




ANP_B_6(2DXD)
NDK_PYRHO
[Raw transfer]




ADP_B_11(3Q8Y)
NDK_STAAC
[Raw transfer]




POP_I_9(1B99)
NDKC_DICDI
[Raw transfer]




POP_J_10(1B99)
NDKC_DICDI
[Raw transfer]




FUP_G_7(1B99)
NDKC_DICDI
[Raw transfer]




POP_K_11(1B99)
NDKC_DICDI
[Raw transfer]




113 HHSearch 96.9799%-118 - C7 -4ANE 3.4 NDK_MYCTU
4 PsiBlast_PDB 96.9699%-118 - C7 -4ANE 3.4 NDK_MYCTU
1 PsiBlast_PDB 96.56100%-124 - C7 -1K44 - NDK_MYCTU -
3 PsiBlast_PDB 95.2799%-124 - C7 -4AND - NDK_MYCTU -
22 PsiBlast_CBE 93.8099%-121 - C7 -4ANE 3.4 NDK_MYCTU
2 PsiBlast_PDB 92.4399%-123 - C7 -4ANC - NDK_MYCTU -
21 PsiBlast_CBE 90.3799%-119 - C7 -4ANE 3.3 NDK_MYCTU
5 PsiBlast_PDB 85.0159%-119 - C7 -3VVT - ? -
39 PsiBlast_CBE 84.9055%-116 - C7 -3Q8U 6.0 NDK_STAAC
41 PsiBlast_CBE 84.7355%-115 - C7 -3Q8U 6.2 NDK_STAAC
26 PsiBlast_CBE 84.7056%-116 - C7 -2DXF - NDK_PYRHO -
46 PsiBlast_CBE 84.4855%-114 - C7 -3Q86 6.5 NDK_STAAC
28 PsiBlast_CBE 84.4656%-117 - C7 -2DXD 4.9 NDK_PYRHO
25 PsiBlast_CBE 84.3956%-116 - C7 -2DY9 - NDK_PYRHO -
8 PsiBlast_PDB 84.3759%-116 - C7 -1WKK 4.9 NDK_THET8
15 PsiBlast_PDB 84.3456%-113 - C7 -2DYA 6.7 NDK_PYRHO
24 PsiBlast_CBE 84.3256%-117 - C7 -2DYA 5.6 NDK_PYRHO
10 PsiBlast_PDB 84.2856%-120 - C7 -2CWK - NDK_PYRHO -
31 PsiBlast_CBE 84.2655%-119 - C7 -3Q8Y - NDK_STAAC -
16 PsiBlast_PDB 84.2155%-115 - C7 -3Q83 - NDK_STAAC -
9 PsiBlast_PDB 84.1359%-119 - C7 -1WKL 6.1 NDK_THET8
13 PsiBlast_PDB 83.9156%-119 - C7 -2DXF 4.5 NDK_PYRHO
30 PsiBlast_CBE 83.8955%-116 - C7 -3Q8Y 5.2 NDK_STAAC
11 PsiBlast_PDB 83.7956%-118 - C7 -2DXD 4.5 NDK_PYRHO
19 PsiBlast_PDB 83.5555%-116 - C7 -3Q8U 6.5 NDK_STAAC
40 PsiBlast_CBE 83.5255%-114 - C7 -3Q8U 5.8 NDK_STAAC
12 PsiBlast_PDB 83.4756%-116 - C7 -2DXE 5.9 NDK_PYRHO
37 PsiBlast_CBE 83.4055%-121 - C7 -3Q8V 4.7 NDK_STAAC
35 PsiBlast_CBE 83.2655%-118 - C7 -3Q8Y 3.7 NDK_STAAC
42 PsiBlast_CBE 83.1755%-115 - C7 -3Q8U 5.6 NDK_STAAC
45 PsiBlast_CBE 83.1355%-119 - C7 -3Q89 5.1 NDK_STAAC
14 PsiBlast_PDB 83.1356%-115 - C7 -2DY9 6.1 NDK_PYRHO
33 PsiBlast_CBE 83.1155%-114 - C7 -3Q8Y 5.4 NDK_STAAC
38 PsiBlast_CBE 82.9455%-118 - C7 -3Q8V 4.8 NDK_STAAC
44 PsiBlast_CBE 82.8955%-117 - C7 -3Q89 4.5 NDK_STAAC
36 PsiBlast_CBE 82.6255%-115 - C7 -3Q8Y 5.2 NDK_STAAC
29 PsiBlast_CBE 82.5755%-118 - C7 -3Q8Y 4.9 NDK_STAAC
20 PsiBlast_PDB 82.4155%-114 - C7 -3Q8V 5.4 NDK_STAAC
43 PsiBlast_CBE 82.3755%-115 - C7 -3Q8U 5.6 NDK_STAAC
17 PsiBlast_PDB 82.2355%-111 - C7 -3Q86 5.6 NDK_STAAC
23 PsiBlast_CBE 81.4659%-120 - C7 -1WKL 5.9 NDK_THET8
32 PsiBlast_CBE 81.4255%-116 - C7 -3Q8Y 5.6 NDK_STAAC
117 HHSearch 81.4151%-105 - C7 -1NHK 5.5 NDK_MYXXA
75 PsiBlast_CBE 80.1553%-110 - C7 -1ZS6 5.9 NDK3_HUMAN
77 PsiBlast_CBE 79.6153%-117 - C7 -1ZS6 6.6 NDK3_HUMAN
60 PsiBlast_CBE 79.3354%-118 - C7 -1HIY 5.0 NDKC_DICDI
102 Fugue 79.3251%-112 - C7 -1NDP 6.7 NDKC_DICDI
56 PsiBlast_CBE 79.0854%-114 - C7 -1KDN 6.5 NDKC_DICDI
128 HHSearch 79.0047%-111 - C7 -4FKX 6.2 ?
89 PsiBlast_CBE 78.9653%-121 - C7 -3FKB 2.5 NDKC_DICDI
54 PsiBlast_CBE 78.9554%-114 - C7 -1NDP 6.7 NDKC_DICDI
76 PsiBlast_CBE 78.8953%-112 - C7 -1ZS6 5.4 NDK3_HUMAN
96 PsiBlast_CBE 78.7953%-117 - C7 -1F3F 4.0 NDKC_DICDI
47 PsiBlast_CBE 78.6854%-113 - C7 -2BEF 7.0 NDKC_DICDI
58 PsiBlast_CBE 78.5254%-113 - C7 -1KDN 7.3 NDKC_DICDI
124 HHSearch 78.2847%-109 - C7 -3EVO 4.6 NDK_MIMIV
99 PsiBlast_CBE 78.0053%-113 - C7 -1B4S 7.2 NDKC_DICDI
67 PsiBlast_CBE 77.9154%-116 - C7 -1BUX 6.3 NDKC_DICDI
55 PsiBlast_CBE 77.8854%-118 - C7 -1NDC 6.9 NDKC_DICDI
53 PsiBlast_CBE 77.6754%-116 - C7 -1NDP 7.2 NDKC_DICDI
93 PsiBlast_CBE 77.6553%-117 - C7 -1MN9 5.4 NDKC_DICDI
57 PsiBlast_CBE 77.6454%-115 - C7 -1KDN 6.5 NDKC_DICDI
61 PsiBlast_CBE 77.5754%-113 - C7 -1HIY 5.6 NDKC_DICDI
88 PsiBlast_CBE 77.4553%-117 - C7 -3FKB 4.8 NDKC_DICDI
92 PsiBlast_CBE 77.4153%-116 - C7 -3FKB 4.9 NDKC_DICDI
66 PsiBlast_CBE 77.3154%-117 - C7 -1BUX 5.6 NDKC_DICDI
87 PsiBlast_CBE 77.3053%-116 - C7 -3FKB 4.1 NDKC_DICDI
90 PsiBlast_CBE 77.2953%-120 - C7 -3FKB 3.5 NDKC_DICDI
59 PsiBlast_CBE 77.2454%-117 - C7 -1HIY 5.6 NDKC_DICDI
80 PsiBlast_CBE 77.2153%-114 - C7 -1LWX 5.3 NDKC_DICDI
94 PsiBlast_CBE 77.1953%-116 - C7 -1MN9 5.2 NDKC_DICDI
49 PsiBlast_CBE 77.1754%-109 - C7 -2BEF 7.2 NDKC_DICDI
95 PsiBlast_CBE 77.1653%-117 - C7 -1MN9 5.1 NDKC_DICDI
85 PsiBlast_CBE 77.1153%-118 - C7 -4CP5 5.0 NDKC_DICDI
71 PsiBlast_CBE 77.0554%-113 - C7 -1B99 2.0 NDKC_DICDI
91 PsiBlast_CBE 76.9253%-118 - C7 -3FKB 4.5 NDKC_DICDI
63 PsiBlast_CBE 76.7354%-112 - C7 -1F6T 6.9 NDKC_DICDI
101 PsiBlast_CBE 76.5553%-114 - C7 -1B4S 7.5 NDKC_DICDI
82 PsiBlast_CBE 76.5553%-116 - C7 -4CP5 5.2 NDKC_DICDI
65 PsiBlast_CBE 76.5254%-114 - C7 -1BUX 5.2 NDKC_DICDI
52 PsiBlast_CBE 76.4154%-119 - C7 -1S5Z 5.4 NDKC_DICDI
81 PsiBlast_CBE 76.3453%-116 - C7 -4CP5 4.7 NDKC_DICDI
97 PsiBlast_CBE 76.2753%-113 - C7 -1F3F 6.5 NDKC_DICDI
98 PsiBlast_CBE 76.1853%-112 - C7 -1F3F 5.1 NDKC_DICDI
79 PsiBlast_CBE 76.1853%-115 - C7 -1LWX 5.5 NDKC_DICDI
72 PsiBlast_CBE 76.1454%-113 - C7 -1B99 3.2 NDKC_DICDI
68 PsiBlast_CBE 76.1254%-110 - C7 -1B99 3.4 NDKC_DICDI
64 PsiBlast_CBE 76.0554%-113 - C7 -1F6T 6.9 NDKC_DICDI
83 PsiBlast_CBE 75.9353%-117 - C7 -4CP5 4.9 NDKC_DICDI
84 PsiBlast_CBE 75.8053%-115 - C7 -4CP5 5.3 NDKC_DICDI
73 PsiBlast_CBE 75.7154%-111 - C7 -1B99 5.0 NDKC_DICDI
48 PsiBlast_CBE 75.7154%-117 - C7 -2BEF 6.6 NDKC_DICDI
78 PsiBlast_CBE 75.6953%-111 - C7 -1LWX 4.9 NDKC_DICDI
69 PsiBlast_CBE 75.5354%-113 - C7 -1B99 3.3 NDKC_DICDI
86 PsiBlast_CBE 75.5253%-115 - C7 -4CP5 5.1 NDKC_DICDI
70 PsiBlast_CBE 75.4554%-114 - C7 -1B99 3.7 NDKC_DICDI
62 PsiBlast_CBE 75.2654%-113 - C7 -1F6T 6.6 NDKC_DICDI
100 PsiBlast_CBE 74.8253%-110 - C7 -1B4S 6.3 NDKC_DICDI
114 HHSearch 73.6845%-100 - C7 -3ZTP 2.5 NDK_AQUAE