@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2523c: (2016-05-11 )
MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTIHVSLTHEGDTAAAVAILEAP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_A_5(3HQJ)
ACPS_MYCTU
[Raw transfer]




2 PsiBlast_PDB 95.22100%-111 - C6 -3NE3 - ACPS_MYCTU -
21 PsiBlast_CBE 94.82100%-113 - C6 -3NE1 - ACPS_MYCTU -
5 PsiBlast_PDB 93.5099%-116 - C6 -4HC6 - ACPS_MYCTU -
22 PsiBlast_CBE 93.42100%-118 - C6 -3NE1 - ACPS_MYCTU -
1 PsiBlast_PDB 91.88100%-121 - C6 -3NE1 - ACPS_MYCTU -
3 PsiBlast_PDB 88.74100%-121 - C6 -3H7Q - ACPS_MYCTU -
6 PsiBlast_PDB 87.8686%-104 - C6 -3GWM - ACPS_MYCS2 -
4 PsiBlast_PDB 85.7498%-126 - C6 -3HQJ 6.0 ACPS_MYCTU
52 HHSearch 85.0883%-102 - C6 -3GWM - ACPS_MYCS2 -
32 PsiBlast_CBE 75.0034%-119 - C6 -2WDS - ACPS_STRCO -
13 PsiBlast_PDB 74.9235%-122 - C6 -2JBZ - ACPS_STRCO -
15 PsiBlast_PDB 74.7135%-120 - C6 -2WDO - ACPS_STRCO -
16 PsiBlast_PDB 73.6535%-116 - C6 -2WDY - ACPS_STRCO -
14 PsiBlast_PDB 72.1635%-116 - C6 -2JCA - ACPS_STRCO -
31 PsiBlast_CBE 70.0135%-113 - C6 -2JCA - ACPS_STRCO -
63 HHSearch 69.4836% -93 - C6 -2WDS - ACPS_STRCO -
30 PsiBlast_CBE 68.9135%-115 - C6 -2JCA - ACPS_STRCO -
28 PsiBlast_CBE 68.7143%-100 - C6 -3NE9 - ? -
7 PsiBlast_PDB 67.6443%-106 - C6 -3NE9 - ? -
25 PsiBlast_CBE 67.5743%-103 - C6 -3NFD - ? -