@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2688c: (2016-05-12 )
MTALNRAVASARVGTEVIRVRGLTFRYPKAAEPAVRGMEFTVGRGEIFGLLGPSGAGKSTTQKLLIGLLRDHGGQATVWDKEPAEWGPDYYERIGVSFELPNHYQKLTGYENLRFFASLYAGATADPMQLLAAVGLADDAHTLVGKYSKGMQMRLPFARSLINDPELLFLDEPTSGLDPVNARKIKDIIVDLKARGRTIFLTTHDMATADELCDRVAFVVDGRIVALDSPTELKIARSRRRVRVEYRGDGGGLETAEFGMDGLADDPAFHSVLRNHHVETIHSREASLDDVFVEVTGRQLT

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_6(4YMV)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ADP_A_3(4YER)
?
[Raw transfer]




1 PsiBlast_PDB 84.1137% -97 - C1 -1VPL - ? -
49 HHSearch 81.8928% -89 - C1 -3TUI - METN_ECOLI -
68 Fugue 80.6826% -77 - C1 -1Z47 - ? -
64 Fugue 79.9824% -86 - C1 -3TUZ - METN_ECOLI -
16 PsiBlast_PDB 79.7328% -89 - C1 -4WBS - ? -
10 PsiBlast_PDB 79.5330% -81 - C1 -1OXU - ? -
11 PsiBlast_PDB 79.4830% -80 - C1 -1OXV - ? -
9 PsiBlast_PDB 78.8030% -81 - C1 -1OXT - ? -
43 HHSearch 78.3430% -77 - C1 -1Z47 - ? -
7 PsiBlast_PDB 77.9131% -86 - C1 -4YMW - ? -
4 PsiBlast_PDB 77.7431% -87 - C1 -4YMT - ? -
38 PsiBlast_CBE 77.6832%-101 - C1 -2YYZ - ? -
8 PsiBlast_PDB 77.5930% -77 - C1 -1OXS - ? -
66 Fugue 77.5824% -74 - C1 -1OXS - ? -
13 PsiBlast_PDB 77.3429% -74 - C1 -1OXX - ? -
3 PsiBlast_PDB 77.3131% -91 - C1 -4YMS - ? -
22 PsiBlast_CBE 76.9431% -84 - C1 -4YMU 4.6 ?
5 PsiBlast_PDB 76.7031% -88 - C1 -4YMU - ? -
70 Fugue 76.4827% -79 - C1 -1B0U - HISP_SALTY -
6 PsiBlast_PDB 76.4531% -85 - C1 -4YMV - ? -
21 PsiBlast_CBE 76.0831% -85 - C1 -4YMV 4.6 ?
17 PsiBlast_PDB 75.2231% -81 - C1 -3C41 5.4 ?
42 HHSearch 54.6137% 13 - C1 -4YER 2.6 ?