@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2697c: (2016-05-13 )
MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL

Atome Classification :

(80 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEG_C_10(3F4F)
DUT_YEAST
[Raw transfer]




DUD_B_9(3C3I)
?
[Raw transfer]




DUT_C_8(1SM8)
DUT_MYCTU
[Raw transfer]




DUT_C_10(1SM8)
DUT_MYCTU
[Raw transfer]




DUP_B_8(4OOP)
DUT_ARATH
[Raw transfer]




DUD_C_7(1SLH)
DUT_MYCTU
[Raw transfer]




DUP_B_8(4OOP)
DUT_ARATH
[Raw transfer]




DUP_C_12(3EHW)
DUT_HUMAN
[Raw transfer]




UMP_C_5(2OL1)
?
[Raw transfer]




UMP_C_5(2OL1)
?
[Raw transfer]




DUP_C_8(2OKE)
?
[Raw transfer]




UMP_C_12(1SNF)
DUT_MYCTU
[Raw transfer]




DUP_C_11(2HQU)
DUT_HUMAN
[Raw transfer]




UMP_C_5(2OL1)
?
[Raw transfer]




UMP_C_5(2OL1)
?
[Raw transfer]




DUD_B_6(1Q5H)
DUT_HUMAN
[Raw transfer]




DUP_B_8(4GV8)
?
[Raw transfer]




DUP_B_7(3P48)
DUT_YEAST
[Raw transfer]




DUD_C_7(1Q5H)
DUT_HUMAN
[Raw transfer]




DUP_B_8(4GV8)
?
[Raw transfer]




EDO_B_12(3MBQ)
DUT_BRUA2
[Raw transfer]




EDO_A_7(3MBQ)
DUT_BRUA2
[Raw transfer]




DUD_C_8(2OL0)
?
[Raw transfer]




UMP_C_9(3F4F)
DUT_YEAST
[Raw transfer]




DUD_B_9(3C3I)
?
[Raw transfer]




EDO_A_6(2OKD)
?
[Raw transfer]




GOL_C_18(3MBQ)
DUT_BRUA2
[Raw transfer]




PEG_C_10(3F4F)
DUT_YEAST
[Raw transfer]




EDO_B_9(2OKB)
?
[Raw transfer]




DUP_B_11(1SJN)
DUT_MYCTU
[Raw transfer]




DUP_B_7(4OOP)
DUT_ARATH
[Raw transfer]




DUP_A_4(3P48)
DUT_YEAST
[Raw transfer]




MSJ_A_4(3ARN)
DUT_HUMAN
[Raw transfer]




DUP_A_4(3P48)
DUT_YEAST
[Raw transfer]




MSJ_C_11(3ARN)
DUT_HUMAN
[Raw transfer]




MSJ_B_8(3ARN)
DUT_HUMAN
[Raw transfer]




DUP_B_6(3P48)
DUT_YEAST
[Raw transfer]




DUR_C_11(4B0H)
YNCF_BACSU
[Raw transfer]




DUP_C_11(4WRK)
?
[Raw transfer]




DUP_D_13(4WRK)
?
[Raw transfer]




DUP_E_15(4GV8)
?
[Raw transfer]




DUT_C_7(1SMC)
DUT_MYCTU
[Raw transfer]




DUP_A_3(3HZA)
DUT_MYCTU
[Raw transfer]




DUP_A_3(3HZA)
DUT_MYCTU
[Raw transfer]




DUP_A_2(4GCY)
DUT_MYCTU
[Raw transfer]




DUP_A_3(2PY4)
DUT_MYCTU
[Raw transfer]




DUP_A_2(3LOJ)
DUT_MYCTU
[Raw transfer]




UMP_A_10(1SNF)
DUT_MYCTU
[Raw transfer]




DUP_B_8(4OOP)
DUT_ARATH
[Raw transfer]




DUP_A_9(1SJN)
DUT_MYCTU
[Raw transfer]




DUP_B_11(1SJN)
DUT_MYCTU
[Raw transfer]




DUT_C_8(1SM8)
DUT_MYCTU
[Raw transfer]




DUP_Y_18(3EHW)
DUT_HUMAN
[Raw transfer]




DUP_Z_20(3EHW)
DUT_HUMAN
[Raw transfer]




DUP_B_11(3EHW)
DUT_HUMAN
[Raw transfer]




DUD_C_7(1SLH)
DUT_MYCTU
[Raw transfer]




DUD_B_6(1Q5H)
DUT_HUMAN
[Raw transfer]




DUP_C_11(2HQU)
DUT_HUMAN
[Raw transfer]




UMP_C_12(1SNF)
DUT_MYCTU
[Raw transfer]




DUP_C_12(3EHW)
DUT_HUMAN
[Raw transfer]




DUD_A_8(1SLH)
DUT_MYCTU
[Raw transfer]




UMP_B_6(3F4F)
DUT_YEAST
[Raw transfer]




MKH_C_8(3ARA)
DUT_HUMAN
[Raw transfer]




MKH_B_6(3ARA)
DUT_HUMAN
[Raw transfer]




MKH_B_6(3ARA)
DUT_HUMAN
[Raw transfer]




DUP_A_6(2OKE)
?
[Raw transfer]




UMP_C_9(3F4F)
DUT_YEAST
[Raw transfer]




DUD_C_6(2OL0)
?
[Raw transfer]




EDO_A_8(3MBQ)
DUT_BRUA2
[Raw transfer]




MKH_C_8(3ARA)
DUT_HUMAN
[Raw transfer]




DUD_B_9(3C3I)
?
[Raw transfer]




DUD_C_8(2OL0)
?
[Raw transfer]




UMP_C_9(3F4F)
DUT_YEAST
[Raw transfer]




EDO_A_2(3MDX)
DUT_BRUA2
[Raw transfer]




EDO_A_2(3MDX)
DUT_BRUA2
[Raw transfer]




EDO_B_13(3MBQ)
DUT_BRUA2
[Raw transfer]




EDO_B_9(2OKB)
?
[Raw transfer]




DU3_C_9(3T64)
?
[Raw transfer]




DUD_A_7(3C3I)
?
[Raw transfer]




DUP_C_8(2OKE)
?
[Raw transfer]




MSJ_C_11(3ARN)
DUT_HUMAN
[Raw transfer]




EDO_A_6(2OKD)
?
[Raw transfer]




EDO_B_7(2OKD)
?
[Raw transfer]




121 HHSearch 96.0399%-139 - C4 -3HZA 3.5 DUT_MYCTU
9 PsiBlast_PDB 96.0299%-139 - C4 -3HZA 3.5 DUT_MYCTU
11 PsiBlast_PDB 95.8699%-142 - C4 -3LOJ 3.5 DUT_MYCTU
7 PsiBlast_PDB 94.63100%-137 - C4 -2PY4 3.6 DUT_MYCTU
10 PsiBlast_PDB 94.6299%-140 - C4 -4GCY 3.5 DUT_MYCTU
2 PsiBlast_PDB 92.15100%-144 - C4 -1SIX - DUT_MYCTU -
1 PsiBlast_PDB 91.47100%-151 - C4 -1MQ7 - DUT_MYCTU -
27 PsiBlast_CBE 91.31100%-150 - C4 -1SLH 3.2 DUT_MYCTU
26 PsiBlast_CBE 90.82100%-156 - C4 -1SLH 3.0 DUT_MYCTU
29 PsiBlast_CBE 90.38100%-147 - C4 -1SJN 3.7 DUT_MYCTU
122 HHSearch 90.17100%-151 - C4 -1SJN 3.2 DUT_MYCTU
23 PsiBlast_CBE 90.16100%-153 - C4 -1SMC 3.6 DUT_MYCTU
6 PsiBlast_PDB 89.97100%-151 - C4 -1SNF 3.4 DUT_MYCTU
3 PsiBlast_PDB 89.95100%-151 - C4 -1SLH 3.2 DUT_MYCTU
8 PsiBlast_PDB 89.53100%-150 - C4 -1SJN 3.7 DUT_MYCTU
4 PsiBlast_PDB 89.48100%-152 - C4 -1SM8 3.4 DUT_MYCTU
22 PsiBlast_CBE 89.35100%-148 - C4 -1SNF 3.8 DUT_MYCTU
21 PsiBlast_CBE 89.26100%-155 - C4 -1SNF 3.4 DUT_MYCTU
25 PsiBlast_CBE 89.05100%-149 - C4 -1SM8 3.4 DUT_MYCTU
24 PsiBlast_CBE 89.04100%-153 - C4 -1SM8 3.3 DUT_MYCTU
126 HHSearch 75.9039%-155 - C4 -4GV8 3.2 ?
81 PsiBlast_CBE 74.0838%-135 - C4 -4OOP 4.1 DUT_ARATH
40 PsiBlast_CBE 72.9343%-149 - C4 -3MBQ 3.0 DUT_BRUA2
58 PsiBlast_CBE 72.5839%-141 - C4 -2HQU 3.8 DUT_HUMAN
43 PsiBlast_CBE 72.4239%-144 - C4 -1Q5H 3.1 DUT_HUMAN
45 PsiBlast_CBE 72.0239%-135 - C4 -3EHW 4.2 DUT_HUMAN
57 PsiBlast_CBE 71.9739%-139 - C4 -2HQU 3.9 DUT_HUMAN
50 PsiBlast_CBE 71.9639%-138 - C4 -3EHW 4.2 DUT_HUMAN
127 HHSearch 71.7145%-133 - C4 -3MDX 3.0 DUT_BRUA2
82 PsiBlast_CBE 71.6938%-138 - C4 -4OOP 3.9 DUT_ARATH
20 PsiBlast_PDB 71.5443%-145 - C4 -3MDX 3.0 DUT_BRUA2
42 PsiBlast_CBE 71.5039%-143 - C4 -1Q5H 3.1 DUT_HUMAN
48 PsiBlast_CBE 71.1839%-134 - C4 -3EHW 3.9 DUT_HUMAN
139 HHSearch 71.1739%-143 - C4 -4OOP 3.9 DUT_ARATH
74 PsiBlast_CBE 71.0237%-141 - C4 -3C3I 2.6 ?
49 PsiBlast_CBE 70.9539%-135 - C4 -3EHW 4.3 DUT_HUMAN
80 PsiBlast_CBE 70.8338%-144 - C4 -4OOP 3.5 DUT_ARATH
75 PsiBlast_CBE 70.2237%-146 - C4 -3C3I 4.4 ?
46 PsiBlast_CBE 70.1239%-132 - C4 -3EHW 4.2 DUT_HUMAN
41 PsiBlast_CBE 69.8643%-143 - C4 -3MBQ 2.4 DUT_BRUA2
19 PsiBlast_PDB 69.6043%-145 - C4 -3MBQ 3.3 DUT_BRUA2
135 HHSearch 69.3245%-144 * C4 *2OL1 4.6 ?
54 PsiBlast_CBE 69.1739%-144 - C4 -3ARA 5.4 DUT_HUMAN
73 PsiBlast_CBE 69.0237%-155 - C4 -3C3I Error ?
65 PsiBlast_CBE 68.8933%-146 - C4 -4GV8 3.4 ?
66 PsiBlast_CBE 68.7633%-147 - C4 -4GV8 3.2 ?
56 PsiBlast_CBE 68.5039%-144 - C4 -3ARA 3.7 DUT_HUMAN
55 PsiBlast_CBE 68.4939%-145 - C4 -3ARA 4.4 DUT_HUMAN
53 PsiBlast_CBE 68.4139%-143 - C4 -3ARN 3.7 DUT_HUMAN
44 PsiBlast_CBE 68.3239%-147 - C4 -1Q5H 3.3 DUT_HUMAN
51 PsiBlast_CBE 68.2239%-144 - C4 -3ARN 3.9 DUT_HUMAN
31 PsiBlast_CBE 68.2145%-135 - C4 -2OL1 5.0 ?
52 PsiBlast_CBE 67.8939%-143 - C4 -3ARN 3.7 DUT_HUMAN
63 PsiBlast_CBE 67.5833%-142 - C4 -4WRK 3.3 ?
76 PsiBlast_CBE 67.4137%-148 - C4 -3C3I 3.0 ?
130 HHSearch 67.2034%-145 - C4 -3F4F 2.5 DUT_YEAST
16 PsiBlast_PDB 67.0545%-132 - C4 -2OL0 3.3 ?
128 HHSearch 66.9541%-138 - C4 -3ARA 4.0 DUT_HUMAN
62 PsiBlast_CBE 66.8933%-146 - C4 -4WRK 2.7 ?
17 PsiBlast_PDB 65.9045%-130 - C4 -2OL1 4.6 ?
34 PsiBlast_CBE 65.7745%-136 - C4 -2OKE 3.2 ?
136 HHSearch 65.6935%-140 - C4 -4B0H 3.3 YNCF_BACSU
33 PsiBlast_CBE 65.6845%-135 - C4 -2OL0 3.1 ?
14 PsiBlast_PDB 65.6645%-130 - C4 -2OKD 3.0 ?
30 PsiBlast_CBE 65.5245%-133 - C4 -2OL1 5.6 ?
15 PsiBlast_PDB 65.2445%-137 - C4 -2OKE 3.2 ?
32 PsiBlast_CBE 64.9545%-134 - C4 -2OL0 3.3 ?
39 PsiBlast_CBE 64.7745%-133 - C4 -2OKB 3.3 ?
131 HHSearch 64.5134%-145 - C4 -3P48 3.1 DUT_YEAST
35 PsiBlast_CBE 63.8345%-129 - C4 -2OKE 2.5 ?
36 PsiBlast_CBE 63.7945%-134 - C4 -2OKD 2.8 ?
37 PsiBlast_CBE 63.6145%-138 - C4 -2OKD 3.0 ?
18 PsiBlast_PDB 61.7045%-126 - C4 -2OKB 3.0 ?
137 HHSearch 61.0835%-112 - C4 -3T64 2.7 ?
117 PsiBlast_CBE 60.1434%-118 - C4 -3F4F 2.7 DUT_YEAST
119 PsiBlast_CBE 59.8934%-119 - C4 -3F4F 2.5 DUT_YEAST
118 PsiBlast_CBE 59.2234%-117 - C4 -3F4F 3.4 DUT_YEAST
90 PsiBlast_CBE 58.3734%-124 - C4 -3P48 4.7 DUT_YEAST
91 PsiBlast_CBE 56.6834%-118 - C4 -3P48 3.4 DUT_YEAST
92 PsiBlast_CBE 55.8934%-121 - C4 -3P48 3.1 DUT_YEAST