@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2745c: (2016-05-13 )
MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTKVVIAPVVSLAVA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MPD_D_9(3F51)
?
[Raw transfer]




MPD_B_8(3F51)
?
[Raw transfer]




MPD_E_10(3F51)
?
[Raw transfer]




GOL_A_3(3F52)
?
[Raw transfer]




MPD_B_8(3F51)
?
[Raw transfer]




MPD_D_9(3F51)
?
[Raw transfer]




GOL_E_7(3F52)
?
[Raw transfer]




22 PsiBlast_CBE 94.3454%-103 - C1 -3F51 4.0 ?
26 PsiBlast_CBE 93.7554%-102 - C1 -3F51 3.7 ?
1 PsiBlast_PDB 93.3854% -98 - C1 -3F51 - ? -
24 PsiBlast_CBE 92.9354%-100 - C1 -3F51 4.0 ?
23 PsiBlast_CBE 92.7854% -98 - C1 -3F51 3.6 ?
25 PsiBlast_CBE 92.5354% -95 - C1 -3F51 3.5 ?
2 PsiBlast_PDB 90.3454% -98 - C1 -3F52 - ? -
21 PsiBlast_CBE 87.0654% -91 - C1 -3F52 2.8 ?
64 Fugue 86.4053% -94 - C1 -3F52 2.3 ?
4 PsiBlast_PDB 71.7128%-119 - C1 -3QQ6 - SINR_BACSU -
54 HHSearch 71.1319% -85 - C1 -3G5G - ? -
5 PsiBlast_PDB 71.0028%-109 - C1 -1B0N - SINR_BACSU -
43 HHSearch 70.8919% -85 * C1 *4I6R - ? -
58 HHSearch 70.3730% -80 - C1 -2B5A - ? -
3 PsiBlast_PDB 69.7931% -87 - C1 -2B5A - ? -
27 PsiBlast_CBE 69.2431% -86 - C1 -2B5A - ? -
6 PsiBlast_PDB 69.2428%-116 - C1 -3ZKC - SINR_BACSU -
60 HHSearch 66.9720% -96 - C1 -3FYM - ? -
16 PsiBlast_PDB 66.4726% -85 - C1 -1Y9Q - ? -
7 PsiBlast_PDB 65.0427%-104 - C1 -4RYK - ? -