@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2764c: (2016-05-13 )
MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAPVAV

Atome Classification :

(99 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PFG_A_4(2BBQ)
TYSY_ECOLI
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




D16_D_4(2KCE)
TYSY_ECOLI
[Raw transfer]




D16_F_6(2KCE)
TYSY_ECOLI
[Raw transfer]




C2F_A_6(4FOG)
TYSY_MYCTU
[Raw transfer]




LYA_B_6(4FQS)
TYSY_MYCTU
[Raw transfer]




C2F_D_11(4FOG)
TYSY_MYCTU
[Raw transfer]




UFP_C_7(4FOA)
TYSY_MYCTU
[Raw transfer]




NDU_A_3(3B5B)
TYSY_ECOLI
[Raw transfer]




LYA_A_4(4FQS)
TYSY_MYCTU
[Raw transfer]




LYA_A_4(4FQS)
TYSY_MYCTU
[Raw transfer]




CB3_B_6(2TSC)
TYSY_ECOLI
[Raw transfer]




PFG_B_6(2BBQ)
TYSY_ECOLI
[Raw transfer]




UFP_D_8(4FOA)
TYSY_MYCTU
[Raw transfer]




UMP_A_5(3QJ7)
TYSY_MYCTU
[Raw transfer]




D16_A_7(3NRR)
?
[Raw transfer]




C2F_C_9(4FOG)
TYSY_MYCTU
[Raw transfer]




CB3_A_4(2TSC)
TYSY_ECOLI
[Raw transfer]




F89_I_9(1F28)
TYSY_PNECA
[Raw transfer]




UMP_C_8(3QJ7)
TYSY_MYCTU
[Raw transfer]




UFP_B_7(4FOG)
TYSY_MYCTU
[Raw transfer]




BVP_A_5(4XSC)
TYSY_VZVO
[Raw transfer]




UMP_A_3(4DQ1)
TYSY_STAAM
[Raw transfer]




UFP_B_6(4FOA)
TYSY_MYCTU
[Raw transfer]




UMP_B_7(3QJ7)
TYSY_MYCTU
[Raw transfer]




UMP_A_3(2VET)
TYSY_ECOLI
[Raw transfer]




UMP_D_9(3QJ7)
TYSY_MYCTU
[Raw transfer]




NDN_B_4(3B5B)
TYSY_ECOLI
[Raw transfer]




UFP_A_5(4FOA)
TYSY_MYCTU
[Raw transfer]




UMP_C_7(1J3K)
?
[Raw transfer]




UMP_C_7(4H0U)
TYSY_CORGL
[Raw transfer]




UMP_A_5(4H0U)
TYSY_CORGL
[Raw transfer]




UMP_D_8(4H0U)
TYSY_CORGL
[Raw transfer]




UMP_B_6(4H0U)
TYSY_CORGL
[Raw transfer]




UMP_A_5(3QG2)
?
[Raw transfer]




GOL_D_(2A9W)
TYSY_ECOLI
[Raw transfer]




GOL_A_5(1F4B)
TYSY_ECOLI
[Raw transfer]




CIT_A_5(3V8H)
?
[Raw transfer]




C2F_G_7(1TSN)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(4KNZ)
TYSY_ECOLI
[Raw transfer]




C2F_B_6(1TLS)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(4KNZ)
TYSY_ECOLI
[Raw transfer]




THG_A_4(3BHL)
TYSY_ECOLI
[Raw transfer]




CB3_D_4(1DNA)
TYSY_ECOLI
[Raw transfer]




CB3_B_7(4KNZ)
TYSY_ECOLI
[Raw transfer]




C2F_A_4(1TLS)
TYSY_ECOLI
[Raw transfer]




LYB_F_6(1JTU)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1KCE)
TYSY_ECOLI
[Raw transfer]




THG_A_3(3BHR)
TYSY_ECOLI
[Raw transfer]




LY3_D_4(1JTQ)
TYSY_ECOLI
[Raw transfer]




MTX_A_4(1AXW)
TYSY_ECOLI
[Raw transfer]




CB3_X_5(2FTO)
TYSY_ECOLI
[Raw transfer]




1PE_A_6(4XSC)
TYSY_VZVO
[Raw transfer]




LY3_F_6(1JTQ)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1ZPR)
TYSY_ECOLI
[Raw transfer]




F89_A_4(1TLC)
TYSY_ECOLI
[Raw transfer]




THG_B_8(3BHL)
TYSY_ECOLI
[Raw transfer]




CB3_B_8(1DDU)
TYSY_ECOLI
[Raw transfer]




CB3_E_5(1TRG)
TYSY_ECOLI
[Raw transfer]




EDO_I_9(1HW4)
TYSY_HUMAN
[Raw transfer]




CB3_B_6(1AN5)
TYSY_ECOLI
[Raw transfer]




CB3_A_6(1TDU)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1ZPR)
TYSY_ECOLI
[Raw transfer]




F89_A_6(1TSD)
TYSY_ECOLI
[Raw transfer]




LYD_D_4(1JUT)
TYSY_ECOLI
[Raw transfer]




MTX_B_6(1AXW)
TYSY_ECOLI
[Raw transfer]




F89_B_6(1TLC)
TYSY_ECOLI
[Raw transfer]




LYB_D_4(1JTU)
TYSY_ECOLI
[Raw transfer]




TMF_A_3(1BJG)
TYSY_ECOLI
[Raw transfer]




CB3_F_6(1DNA)
TYSY_ECOLI
[Raw transfer]




F89_F_6(1SYN)
TYSY_ECOLI
[Raw transfer]




THG_J_10(1KZI)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1KCE)
TYSY_ECOLI
[Raw transfer]




F89_E_4(1SYN)
TYSY_ECOLI
[Raw transfer]




THG_G_7(1KZI)
TYSY_ECOLI
[Raw transfer]




NDU_A_4(3B9H)
TYSY_ECOLI
[Raw transfer]




UMP_C_3(1BID)
TYSY_ECOLI
[Raw transfer]




F89_B_8(1TSD)
TYSY_ECOLI
[Raw transfer]




CB3_B_8(1TDU)
TYSY_ECOLI
[Raw transfer]




DDU_E_5(1AOB)
TYSY_ECOLI
[Raw transfer]




DUR_E_5(1BDU)
TYSY_ECOLI
[Raw transfer]




CB3_A_5(1AN5)
TYSY_ECOLI
[Raw transfer]




CB3_A_6(1DDU)
TYSY_ECOLI
[Raw transfer]




TP2_A_8(1F4C)
TYSY_ECOLI
[Raw transfer]




LYD_F_6(1JUT)
TYSY_ECOLI
[Raw transfer]




TP2_B_9(1F4C)
TYSY_ECOLI
[Raw transfer]




GA9_A_18(2A9W)
TYSY_ECOLI
[Raw transfer]




GA9_B_22(2A9W)
TYSY_ECOLI
[Raw transfer]




GA9_C_25(2A9W)
TYSY_ECOLI
[Raw transfer]




TPR_A_6(1F4E)
TYSY_ECOLI
[Raw transfer]




TP3_B_9(1F4F)
TYSY_ECOLI
[Raw transfer]




TP3_A_8(1F4F)
TYSY_ECOLI
[Raw transfer]




29 PsiBlast_CBE 97.29100%-142 - C8 -4FOX - TYSY_MYCTU -
33 PsiBlast_CBE 97.28100%-144 - C8 -4FOX - TYSY_MYCTU -
4 PsiBlast_PDB 97.13100%-143 - C8 -4FOX - TYSY_MYCTU -
108 HHSearch 97.04100%-136 - C8 -4FQS 5.8 TYSY_MYCTU
5 PsiBlast_PDB 97.04100%-136 - C8 -4FQS 5.8 TYSY_MYCTU
27 PsiBlast_CBE 96.61100%-135 - C8 -4FQS 5.4 TYSY_MYCTU
30 PsiBlast_CBE 96.59100%-140 - C8 -4FOX - TYSY_MYCTU -
32 PsiBlast_CBE 96.46100%-139 - C8 -4FOX - TYSY_MYCTU -
22 PsiBlast_CBE 96.40100%-139 - C8 -4FOA 5.7 TYSY_MYCTU
34 PsiBlast_CBE 96.38100%-138 - C8 -4FOX - TYSY_MYCTU -
35 PsiBlast_CBE 96.30100%-138 - C8 -4FOG 5.9 TYSY_MYCTU
31 PsiBlast_CBE 96.29100%-140 - C8 -4FOX - TYSY_MYCTU -
2 PsiBlast_PDB 96.16100%-139 - C8 -4FOA 4.7 TYSY_MYCTU
21 PsiBlast_CBE 96.06100%-139 - C8 -4FOA 5.5 TYSY_MYCTU
3 PsiBlast_PDB 95.95100%-141 - C8 -4FOG 5.3 TYSY_MYCTU
28 PsiBlast_CBE 95.85100%-140 - C8 -4FOX - TYSY_MYCTU -
25 PsiBlast_CBE 95.78100%-141 - C8 -3QJ7 4.8 TYSY_MYCTU
24 PsiBlast_CBE 95.77100%-141 - C8 -3QJ7 4.4 TYSY_MYCTU
36 PsiBlast_CBE 95.62100%-134 - C8 -4FOG 5.7 TYSY_MYCTU
1 PsiBlast_PDB 95.61100%-138 - C8 -3QJ7 5.8 TYSY_MYCTU
26 PsiBlast_CBE 95.60100%-142 - C8 -3QJ7 4.5 TYSY_MYCTU
37 PsiBlast_CBE 95.42100%-141 - C8 -4FOG 3.3 TYSY_MYCTU
23 PsiBlast_CBE 95.04100%-141 - C8 -4FOA 5.0 TYSY_MYCTU
7 PsiBlast_PDB 86.4473%-141 - C8 -4H0U 4.3 TYSY_CORGL
38 PsiBlast_CBE 86.3773%-143 - C8 -4H0U 4.5 TYSY_CORGL
40 PsiBlast_CBE 85.8173%-139 - C8 -4H0U 4.4 TYSY_CORGL
42 PsiBlast_CBE 85.4566%-131 - C8 -2BBQ 7.2 TYSY_ECOLI
54 PsiBlast_CBE 85.4165%-130 - C8 -2VET 4.7 TYSY_ECOLI
53 PsiBlast_CBE 85.2265%-126 - C8 -3B5B 4.8 TYSY_ECOLI
56 PsiBlast_CBE 85.1166%-132 - C8 -2TSC 7.4 TYSY_ECOLI
9 PsiBlast_PDB 85.0766%-130 - C8 -2KCE 7.0 TYSY_ECOLI
52 PsiBlast_CBE 85.0565%-127 - C8 -3B5B 5.9 TYSY_ECOLI
55 PsiBlast_CBE 84.4566%-132 - C8 -2TSC 7.3 TYSY_ECOLI
39 PsiBlast_CBE 84.3273%-137 - C8 -4H0U 4.7 TYSY_CORGL
8 PsiBlast_PDB 84.2166%-127 - C8 -2BBQ 7.5 TYSY_ECOLI
41 PsiBlast_CBE 83.9266%-130 - C8 -2KCE 6.5 TYSY_ECOLI
102 HHSearch 81.0858%-132 - C8 -4DQ1 4.8 TYSY_STAAM
121 HHSearch 79.5449%-131 - C8 -3NRR 6.1 ?
109 HHSearch 79.4953%-137 - C8 -1HW4 2.3 TYSY_HUMAN
111 HHSearch 79.1245%-129 - C8 -1J3K 5.4 ?
118 HHSearch 79.0045%-130 - C8 -3QG2 4.7 ?
104 HHSearch 78.7253%-123 - C8 -4EZ8 4.8 TYSY_MOUSE
116 HHSearch 77.5149%-129 - C8 -4XSC 5.5 TYSY_VZVO
110 HHSearch 77.4348%-120 - C8 -1F28 6.6 TYSY_PNECA
112 HHSearch 72.6141%-125 - C8 -3V8H 3.2 ?
47 PsiBlast_CBE 50.5766% -28 - C8 -1SYN 5.4 TYSY_ECOLI
68 PsiBlast_CBE 50.5366% -29 - C8 -3BHL 4.7 TYSY_ECOLI
45 PsiBlast_CBE 50.4766% -31 - C8 -1TLC 4.2 TYSY_ECOLI
95 PsiBlast_CBE 50.4266% -26 - C8 -1ZPR 5.5 TYSY_ECOLI
44 PsiBlast_CBE 50.1766% -29 - C8 -1TRG 4.5 TYSY_ECOLI
43 PsiBlast_CBE 50.1366% -28 - C8 -1TSD 5.6 TYSY_ECOLI
12 PsiBlast_PDB 50.1266% -26 - C8 -1TLC 5.0 TYSY_ECOLI
81 PsiBlast_CBE 50.1166% -28 - C8 -1KCE 4.4 TYSY_ECOLI
69 PsiBlast_CBE 50.0566% -24 - C8 -3BHL 4.7 TYSY_ECOLI
78 PsiBlast_CBE 49.9966% -23 - C8 -1TLS 3.5 TYSY_ECOLI
13 PsiBlast_PDB 49.9966% -28 - C8 -1TSD 5.3 TYSY_ECOLI
77 PsiBlast_CBE 49.8766% -31 - C8 -1TLS 3.7 TYSY_ECOLI
90 PsiBlast_CBE 49.7966% -26 - C8 -1F4F 2.7 TYSY_ECOLI
101 HHSearch 49.6667% -25 * C8 *4KNZ 4.0 TYSY_ECOLI
46 PsiBlast_CBE 49.6566% -28 - C8 -1TDU 3.6 TYSY_ECOLI
87 PsiBlast_CBE 49.6366% -28 - C8 -1JTQ 4.3 TYSY_ECOLI
83 PsiBlast_CBE 49.6266% -28 - C8 -1JUT 5.1 TYSY_ECOLI
57 PsiBlast_CBE 49.5566% -26 - C8 -4KNZ 4.9 TYSY_ECOLI
48 PsiBlast_CBE 49.5466% -26 - C8 -1SYN 5.2 TYSY_ECOLI
58 PsiBlast_CBE 49.5366% -25 - C8 -4KNZ 4.0 TYSY_ECOLI
67 PsiBlast_CBE 49.5066% -26 - C8 -3BHR 4.9 TYSY_ECOLI
15 PsiBlast_PDB 49.3066% -29 - C8 -1TDU 4.1 TYSY_ECOLI
19 PsiBlast_PDB 49.2766% -25 - C8 -1BID 2.9 TYSY_ECOLI
74 PsiBlast_CBE 49.2666% -25 - C8 -2A9W 4.2 TYSY_ECOLI
18 PsiBlast_PDB 49.2466% -23 - C8 -1BDU 2.7 TYSY_ECOLI
98 PsiBlast_CBE 49.2266% -27 - C8 -1DNA 3.3 TYSY_ECOLI
94 PsiBlast_CBE 49.1666% -26 - C8 -1F4B 2.7 TYSY_ECOLI
75 PsiBlast_CBE 49.1166% -27 - C8 -2A9W 4.8 TYSY_ECOLI
17 PsiBlast_PDB 49.1066% -27 - C8 -1AXW 5.2 TYSY_ECOLI
14 PsiBlast_PDB 49.0466% -24 - C8 -1DDU 4.1 TYSY_ECOLI
82 PsiBlast_CBE 49.0366% -26 - C8 -1KCE 3.8 TYSY_ECOLI
70 PsiBlast_CBE 49.0266% -28 - C8 -3B9H 0.5 TYSY_ECOLI
72 PsiBlast_CBE 49.0066% -26 - C8 -2A9W 1.7 TYSY_ECOLI
80 PsiBlast_CBE 48.9766% -26 - C8 -1KZI 3.1 TYSY_ECOLI
50 PsiBlast_CBE 48.9666% -26 - C8 -1AXW 4.7 TYSY_ECOLI
85 PsiBlast_CBE 48.9566% -26 - C8 -1JTU 5.5 TYSY_ECOLI
93 PsiBlast_CBE 48.9166% -27 - C8 -1F4C 2.8 TYSY_ECOLI
51 PsiBlast_CBE 48.8566% -23 - C8 -1AN5 4.5 TYSY_ECOLI
79 PsiBlast_CBE 48.7866% -29 - C8 -1KZI 2.8 TYSY_ECOLI
100 PsiBlast_CBE 48.7666% -23 - C8 -2FTO 3.9 TYSY_ECOLI
16 PsiBlast_PDB 48.7566% -24 - C8 -1AN5 5.6 TYSY_ECOLI
11 PsiBlast_PDB 48.7366% -24 - C8 -1AOB 3.4 TYSY_ECOLI
49 PsiBlast_CBE 48.7166% -24 - C8 -1DDU 3.3 TYSY_ECOLI
96 PsiBlast_CBE 48.7066% -27 - C8 -1ZPR 3.6 TYSY_ECOLI
89 PsiBlast_CBE 48.6766% -30 - C8 -1F4F 1.5 TYSY_ECOLI
86 PsiBlast_CBE 48.6766% -25 - C8 -1JTU 3.5 TYSY_ECOLI
76 PsiBlast_CBE 48.6766% -25 - C8 -1TSN 4.5 TYSY_ECOLI
91 PsiBlast_CBE 48.6266% -25 - C8 -1F4E 2.7 TYSY_ECOLI
97 PsiBlast_CBE 48.5466% -25 - C8 -1DNA 4.2 TYSY_ECOLI
73 PsiBlast_CBE 48.5466% -26 - C8 -2A9W 5.4 TYSY_ECOLI
84 PsiBlast_CBE 48.3466% -21 - C8 -1JUT 5.1 TYSY_ECOLI
88 PsiBlast_CBE 48.1866% -27 - C8 -1JTQ 4.6 TYSY_ECOLI
99 PsiBlast_CBE 47.9966% -28 - C8 -1BJG 1.9 TYSY_ECOLI
92 PsiBlast_CBE 46.6966% -27 - C8 -1F4C 2.4 TYSY_ECOLI