@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2919c: (2016-05-14 )
MKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAEYSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDAL

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_C_8(1UL3)
GLNB_SYNY3
[Raw transfer]




ATP_B_5(3LF0)
GLNB_MYCTU
[Raw transfer]




ATP_C_6(3LF0)
GLNB_MYCTU
[Raw transfer]




ATP_A_4(3LF0)
GLNB_MYCTU
[Raw transfer]




ADP_B_8(4CNZ)
?
[Raw transfer]




ADP_A_7(4CNZ)
?
[Raw transfer]




ATP_C_16(2XZW)
GLNB_SYNE7
[Raw transfer]




ADP_C_9(4CNZ)
?
[Raw transfer]




ATP_B_10(2XUL)
GLNB_SYNE7
[Raw transfer]




ATP_H_25(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_B_9(3MHY)
?
[Raw transfer]




ADP_A_3(4CO1)
?
[Raw transfer]




ATP_D_19(2XZW)
GLNB_SYNE7
[Raw transfer]




ADP_A_3(4CO2)
?
[Raw transfer]




ADP_F_12(4CNZ)
?
[Raw transfer]




ATP_G_24(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_D_16(2XUL)
GLNB_SYNE7
[Raw transfer]




ATP_B_11(2J9C)
Y059_METJA
[Raw transfer]




ADP_D_10(4CNZ)
?
[Raw transfer]




ATP_C_15(3MHY)
?
[Raw transfer]




ATP_F_21(2XZW)
GLNB_SYNE7
[Raw transfer]




ADP_C_8(4C3K)
GLNB_SYNE7
[Raw transfer]




ADP_E_11(4CNZ)
?
[Raw transfer]




ATP_A_2(4AFF)
GLNB_SYNE7
[Raw transfer]




ATP_A_2(4AFF)
GLNB_SYNE7
[Raw transfer]




ATP_E_19(2XUL)
GLNB_SYNE7
[Raw transfer]




ATP_A_4(2J9E)
Y059_METJA
[Raw transfer]




ATP_A_7(2XUL)
GLNB_SYNE7
[Raw transfer]




ADP_F_11(4C3K)
GLNB_SYNE7
[Raw transfer]




ATP_C_10(2J9E)
Y059_METJA
[Raw transfer]




ADP_B_4(4CO0)
?
[Raw transfer]




ADP_B_5(4CO2)
?
[Raw transfer]




ATP_B_13(2XZW)
GLNB_SYNE7
[Raw transfer]




ADP_A_3(4CO0)
?
[Raw transfer]




ADP_D_9(4C3K)
GLNB_SYNE7
[Raw transfer]




ATP_E_20(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_B_8(2J9E)
Y059_METJA
[Raw transfer]




ATP_A_3(2EG2)
GLNB_AQUAE
[Raw transfer]




ATP_A_3(2EG2)
GLNB_AQUAE
[Raw transfer]




ATP_D_4(2GNK)
GLNK_ECOLI
[Raw transfer]




ADP_B_4(4CO1)
?
[Raw transfer]




ATP_C_16(2J9C)
Y059_METJA
[Raw transfer]




ADP_A_3(3N5B)
?
[Raw transfer]




ATP_A_4(4CO4)
?
[Raw transfer]




ATP_B_7(4CO4)
?
[Raw transfer]




ATP_A_4(3NCQ)
?
[Raw transfer]




AMP_C_9(4CO4)
?
[Raw transfer]




ADP_B_11(2NS1)
GLNK_ECOLI
[Raw transfer]




ADP_B_11(2NS1)
GLNK_ECOLI
[Raw transfer]




AKG_B_10(3MHY)
?
[Raw transfer]




AKG_A_6(4USI)
?
[Raw transfer]




AKG_C_16(3MHY)
?
[Raw transfer]




AKG_C_12(3TA2)
?
[Raw transfer]




AKG_A_5(3TA2)
?
[Raw transfer]




AKG_B_8(3TA2)
?
[Raw transfer]




TLA_A_2(4CO5)
?
[Raw transfer]




FLC_D_4(2O66)
GLNB_ARATH
[Raw transfer]




22 PsiBlast_CBE 91.59100%-138 - C6 -3LF0 6.2 GLNB_MYCTU
1 PsiBlast_PDB 89.86100%-162 - C6 -3LF0 5.0 GLNB_MYCTU
113 HHSearch 88.76100%-154 - C6 -3BZQ - GLNB_MYCTU -
2 PsiBlast_PDB 88.76100%-154 - C6 -3BZQ - GLNB_MYCTU -
21 PsiBlast_CBE 88.27100%-160 - C6 -3LF0 6.1 GLNB_MYCTU
69 PsiBlast_CBE 82.7356%-130 - C6 -3MHY 7.1 ?
70 PsiBlast_CBE 82.4956%-130 - C6 -3MHY 7.4 ?
12 PsiBlast_PDB 82.3659%-127 - C6 -2XBP - GLNB_SYNE7 -
55 PsiBlast_CBE 82.3456%-126 - C6 -4CO2 5.6 ?
41 PsiBlast_CBE 82.1460%-138 - C6 -2XZW 7.6 GLNB_SYNE7
57 PsiBlast_CBE 81.9456%-130 - C6 -4CO1 5.3 ?
82 PsiBlast_CBE 81.7155%-128 - C6 -2J9E 6.5 Y059_METJA
58 PsiBlast_CBE 81.6656%-122 - C6 -4CO1 6.1 ?
94 PsiBlast_CBE 81.5955%-134 - C6 -2J9C 6.5 Y059_METJA
43 PsiBlast_CBE 81.2260%-134 - C6 -2XUL 7.5 GLNB_SYNE7
42 PsiBlast_CBE 81.1360%-132 - C6 -2XZW 7.5 GLNB_SYNE7
37 PsiBlast_CBE 80.9360%-132 - C6 -2XZW 5.6 GLNB_SYNE7
56 PsiBlast_CBE 80.7156%-126 - C6 -4CO2 6.2 ?
96 PsiBlast_CBE 80.6455%-132 - C6 -2J9C - Y059_METJA -
45 PsiBlast_CBE 80.6060%-138 - C6 -2XUL 7.2 GLNB_SYNE7
38 PsiBlast_CBE 80.3760%-137 - C6 -2XZW 7.7 GLNB_SYNE7
40 PsiBlast_CBE 80.3460%-143 - C6 -2XZW 6.6 GLNB_SYNE7
95 PsiBlast_CBE 79.8855%-126 - C6 -2J9C 6.0 Y059_METJA
9 PsiBlast_PDB 79.7760%-140 - C6 -2XUL 7.1 GLNB_SYNE7
60 PsiBlast_CBE 79.7556%-141 - C6 -4CO0 5.1 ?
59 PsiBlast_CBE 79.6856%-137 - C6 -4CO0 4.7 ?
62 PsiBlast_CBE 79.5756%-118 - C6 -4CNZ 6.8 ?
65 PsiBlast_CBE 79.5056%-134 - C6 -4CNZ 5.8 ?
63 PsiBlast_CBE 79.3856%-141 - C6 -4CNZ 6.1 ?
118 HHSearch 79.1360%-142 - C6 -4AFF 7.0 GLNB_SYNE7
61 PsiBlast_CBE 79.0656%-133 - C6 -4CNZ 6.3 ?
15 PsiBlast_PDB 78.9359%-142 - C6 -4AFF 7.0 GLNB_SYNE7
44 PsiBlast_CBE 78.7260%-134 - C6 -2XUL 7.1 GLNB_SYNE7
36 PsiBlast_CBE 78.7260%-129 - C6 -2XZW 7.0 GLNB_SYNE7
83 PsiBlast_CBE 78.5555%-127 - C6 -2J9E 5.0 Y059_METJA
66 PsiBlast_CBE 78.2956%-138 - C6 -4CNZ 6.0 ?
51 PsiBlast_CBE 78.2056%-142 - C6 -4CO5 3.3 ?
84 PsiBlast_CBE 78.0955%-126 - C6 -2J9E 5.8 Y059_METJA
64 PsiBlast_CBE 78.0656%-134 - C6 -4CNZ 6.8 ?
120 HHSearch 77.9254%-124 - C6 -2NS1 6.2 GLNK_ECOLI
79 PsiBlast_CBE 77.7153%-124 - C6 -2NS1 6.2 GLNK_ECOLI
14 PsiBlast_PDB 77.5857%-125 - C6 -3N5B 5.8 ?
30 PsiBlast_CBE 77.1360%-138 - C6 -4C3K 4.4 GLNB_SYNE7
32 PsiBlast_CBE 76.2360%-146 - C6 -4C3K 4.6 GLNB_SYNE7
119 HHSearch 75.0859%-160 - C6 -2EG2 4.8 GLNB_AQUAE
17 PsiBlast_PDB 74.9058%-160 - C6 -2EG2 4.8 GLNB_AQUAE
52 PsiBlast_CBE 74.7656%-148 - C6 -4CO4 4.0 ?
54 PsiBlast_CBE 74.3856%-150 - C6 -4CO4 4.5 ?
33 PsiBlast_CBE 73.7060%-144 - C6 -4C3K 5.0 GLNB_SYNE7
53 PsiBlast_CBE 73.6756%-144 - C6 -4CO4 4.4 ?
39 PsiBlast_CBE 73.1860%-140 - C6 -2XZW 4.7 GLNB_SYNE7
99 PsiBlast_CBE 72.2249%-132 - C6 -3TA2 3.6 ?
98 PsiBlast_CBE 72.0549%-129 - C6 -3TA2 3.4 ?
80 PsiBlast_CBE 72.0453%-126 - C6 -2GNK 4.8 GLNK_ECOLI
11 PsiBlast_PDB 71.2259%-136 - C6 -1UL3 Error GLNB_SYNY3
123 HHSearch 71.1246%-150 - C6 -2O66 3.3 GLNB_ARATH
100 PsiBlast_CBE 70.6849%-125 - C6 -3TA2 2.8 ?
127 HHSearch 70.3646%-119 - C6 -3NCQ 5.3 ?
122 HHSearch 67.4039%-127 - C6 -4USI 2.4 ?