@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2925c: (2016-05-15 )
MIRSRQPLLDALGVDLPDELLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVVNTQALADVARRLCAEGLGVHVLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPLLDAAPTLGAGLDWKTSLQELTAARGLGAPSYLVTSTGPDHDKEFTAVVVVMDSEYGSGVGRSKKEAEQKAAAAAWKALEVLDNAMPGKTSA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

A_C_12(4M30)
RNC_AQUAE
[Raw transfer]




A_D_16(4M30)
RNC_AQUAE
[Raw transfer]




C_C_9(4M2Z)
RNC_AQUAE
[Raw transfer]




C_D_12(4M2Z)
RNC_AQUAE
[Raw transfer]




NACID_D_3(2NUG)
RNC_AQUAE
[Raw transfer]

-

NACID_C_1(2NUG)
RNC_AQUAE
[Raw transfer]

-

NACID_D_3(2NUG)
RNC_AQUAE
[Raw transfer]

-

NACID_D_3(2NUG)
RNC_AQUAE
[Raw transfer]

-

A_D_16(4M30)
RNC_AQUAE
[Raw transfer]




51 HHSearch 89.00100%-129 - C2 -2A11 - RNC_MYCTU -
1 PsiBlast_PDB 89.00100%-129 - C2 -2A11 - RNC_MYCTU -
73 Fugue 76.3538% -70 - C1 -1O0W - RNC_THEMA -
53 HHSearch 76.1738% -77 * C1 *1O0W - RNC_THEMA -
9 PsiBlast_PDB 74.9235%-105 - C2 -2NUG 4.2 RNC_AQUAE
24 PsiBlast_CBE 74.8735%-106 - C2 -2NUG 3.6 RNC_AQUAE
15 PsiBlast_PDB 74.8535% -99 - C2 -2EZ6 - RNC_AQUAE -
30 PsiBlast_CBE 74.8435%-101 - C2 -2EZ6 - RNC_AQUAE -
11 PsiBlast_PDB 74.7835%-100 - C2 -4M30 3.2 RNC_AQUAE
5 PsiBlast_PDB 74.6335%-108 - C2 -1YYK - RNC_AQUAE -
8 PsiBlast_PDB 74.4835% -99 - C2 -2NUF - RNC_AQUAE -
12 PsiBlast_PDB 74.2635%-100 - C2 -1YZ9 - RNC_AQUAE -
10 PsiBlast_PDB 74.1435% -98 - C2 -4M2Z 2.7 RNC_AQUAE
22 PsiBlast_CBE 73.8535%-101 - C2 -4M30 3.1 RNC_AQUAE
27 PsiBlast_CBE 73.4635% -98 * C2 *1YYK - RNC_AQUAE -
28 PsiBlast_CBE 73.2635%-100 - C2 -1YZ9 - RNC_AQUAE -
25 PsiBlast_CBE 73.1435%-101 - C2 -2NUF - RNC_AQUAE -
56 HHSearch 73.0735% -98 - C2 -2NUG 3.7 RNC_AQUAE
23 PsiBlast_CBE 72.8935%-105 - C2 -4M2Z 2.8 RNC_AQUAE
3 PsiBlast_PDB 72.5239% -72 - C1 -1O0W - RNC_THEMA -