@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv2965c: (2016-05-15 )
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTERT

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COD_A_2(3PXU)
COAD_BURP1
[Raw transfer]




ANP_B_12(3X1K)
?
[Raw transfer]




ANP_A_7(3X1K)
?
[Raw transfer]




ATP_F_12(3ND6)
COAD_ENTFA
[Raw transfer]




ATP_A_7(3ND6)
COAD_ENTFA
[Raw transfer]




ADP_A_5(1O6B)
COAD_BACSU
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




ACO_C_17(3X1J)
?
[Raw transfer]




ACO_B_13(3X1J)
?
[Raw transfer]




ADP_A_6(4NAT)
COAD_STAAW
[Raw transfer]




PNS_A_5(3NBK)
COAD_MYCTU
[Raw transfer]




FMT_C_25(4RUK)
?
[Raw transfer]




PNS_A_2(1OD6)
COAD_THET8
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




PNY_D_10(3ND7)
COAD_ENTFA
[Raw transfer]




PNS_C_9(1VLH)
COAD_THEMA
[Raw transfer]




COA_C_23(4RUK)
?
[Raw transfer]




ACO_A_4(3X1J)
?
[Raw transfer]




ACO_B_13(3X1J)
?
[Raw transfer]




25 PsiBlast_CBE 97.78100%-149 - C3 -3NBK - COAD_MYCTU -
23 PsiBlast_CBE 97.55100%-151 - C3 -3PNB - COAD_MYCTU -
24 PsiBlast_CBE 97.44100%-150 - C3 -3NBK - COAD_MYCTU -
115 HHSearch 97.38100%-146 - C3 -3NBK 3.7 COAD_MYCTU
4 PsiBlast_PDB 97.37100%-146 - C3 -3NBK - COAD_MYCTU -
22 PsiBlast_CBE 96.62100%-143 - C3 -3PNB - COAD_MYCTU -
31 PsiBlast_CBE 96.51100%-151 - C3 -4R0N - COAD_MYCTU -
26 PsiBlast_CBE 96.46100%-146 - C3 -3NBK - COAD_MYCTU -
7 PsiBlast_PDB 96.20100%-145 - C3 -3RBA - COAD_MYCTU -
1 PsiBlast_PDB 96.17100%-148 - C3 -3LCJ - COAD_MYCTU -
34 PsiBlast_CBE 95.66100%-146 - C3 -4R0N - COAD_MYCTU -
9 PsiBlast_PDB 95.65100%-145 - C3 -3RHS - COAD_MYCTU -
5 PsiBlast_PDB 95.51100%-146 - C3 -3PNB - COAD_MYCTU -
21 PsiBlast_CBE 95.44100%-147 - C3 -3PNB - COAD_MYCTU -
2 PsiBlast_PDB 95.42100%-140 - C3 -4E1A - COAD_MYCTU -
8 PsiBlast_PDB 95.33100%-142 - C3 -3RFF - COAD_MYCTU -
6 PsiBlast_PDB 95.31100%-144 - C3 -1TFU - COAD_MYCTU -
29 PsiBlast_CBE 94.94100%-146 - C3 -3NBA - COAD_MYCTU -
30 PsiBlast_CBE 94.90100%-140 - C3 -4R0N - COAD_MYCTU -
27 PsiBlast_CBE 94.74100%-147 - C3 -3NBA - COAD_MYCTU -
117 HHSearch 75.0348%-133 - C3 -1VLH 2.2 COAD_THEMA
87 PsiBlast_CBE 73.8139%-146 - C3 -3ND6 5.8 COAD_ENTFA
113 HHSearch 73.7650%-133 - C3 -1OD6 2.9 COAD_THET8
74 PsiBlast_CBE 73.5142%-138 - C3 -3K9W 4.0 COAD_BURP1
118 HHSearch 73.3042%-136 - C3 -3K9W 3.4 COAD_BURP1
124 HHSearch 73.1842%-138 - C3 -1O6B 5.9 COAD_BACSU
82 PsiBlast_CBE 73.1139%-144 - C3 -3ND6 5.2 COAD_ENTFA
75 PsiBlast_CBE 72.3142%-139 - C3 -3PXU 7.8 COAD_BURP1
80 PsiBlast_CBE 71.8039%-141 - C3 -3ND7 3.3 COAD_ENTFA
121 HHSearch 71.0944%-136 - C3 -4NAT 3.9 COAD_STAAW
70 PsiBlast_CBE 70.6140%-130 - C3 -3X1K 5.6 ?
119 HHSearch 69.8841%-127 - C3 -4RUK 3.8 ?
59 PsiBlast_CBE 69.2940%-129 - C3 -4RUK 2.0 ?
71 PsiBlast_CBE 69.2840%-129 - C3 -3X1J 5.2 ?
72 PsiBlast_CBE 69.1340%-126 - C3 -3X1J 5.4 ?
69 PsiBlast_CBE 68.7640%-124 - C3 -3X1K 5.5 ?
73 PsiBlast_CBE 68.0740%-124 - C3 -3X1J 3.8 ?
94 PsiBlast_CBE 63.2335%-153 - C3 -3NV7 3.4 COAD_HELPY
125 HHSearch 62.2634%-143 - C3 -3NV7 3.4 COAD_HELPY