@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3246c: (2016-05-18 )
MDTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_23(5DCL)
?
[Raw transfer]




GOL_A_4(2GWR)
MTRA_MYCTU
[Raw transfer]




EDO_A_16(5DCL)
?
[Raw transfer]




101 HHSearch 95.14100%-144 - C4 -2GWR 3.1 MTRA_MYCTU
1 PsiBlast_PDB 94.4096%-143 - C4 -2GWR - MTRA_MYCTU -
105 HHSearch 75.8943%-124 - C5 -1YS7 - PRRA_MYCTU -
26 PsiBlast_CBE 73.7935%-131 - C4 -4KNY - KDPE_ECOLI -
22 PsiBlast_CBE 73.04100%-156 - C4 -3NHZ - MTRA_MYCTU -
2 PsiBlast_PDB 72.87100%-153 - C4 -3NHZ - MTRA_MYCTU -
21 PsiBlast_CBE 72.46100%-157 - C4 -3NHZ - MTRA_MYCTU -
23 PsiBlast_CBE 72.14100%-155 - C4 -3NHZ - MTRA_MYCTU -
8 PsiBlast_PDB 72.0135%-133 - C4 -4KNY - KDPE_ECOLI -
102 HHSearch 71.2235%-126 - C4 -4KFC - KDPE_ECOLI -
7 PsiBlast_PDB 70.7635%-129 - C4 -4KFC - KDPE_ECOLI -
29 PsiBlast_CBE 70.2732%-135 - C4 -4S04 - ? -
24 PsiBlast_CBE 69.9943%-121 - C5 -1YS7 - PRRA_MYCTU -
25 PsiBlast_CBE 69.6343%-114 - C5 -1YS6 - PRRA_MYCTU -
31 PsiBlast_CBE 69.1632%-133 - C4 -4S04 - ? -
108 HHSearch 68.6632%-122 - C4 -4S04 - ? -
11 PsiBlast_PDB 68.3735%-130 - C4 -1KGS - ? -
4 PsiBlast_PDB 68.3043%-116 - C5 -1YS6 - PRRA_MYCTU -
5 PsiBlast_PDB 68.2943%-119 - C5 -1YS7 - PRRA_MYCTU -
110 HHSearch 67.9135%-123 - C4 -1KGS - ? -