@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3279c: (2016-05-18 )
MTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

44K_A_3(4XTV)
?
[Raw transfer]




44K_B_4(4XTV)
?
[Raw transfer]




44N_B_4(4XU0)
?
[Raw transfer]




44Q_B_4(4XU2)
?
[Raw transfer]




44M_A_3(4XTW)
?
[Raw transfer]




44K_A_3(4XTV)
?
[Raw transfer]




44R_A_3(4XU3)
?
[Raw transfer]




594_B_4(4XTZ)
?
[Raw transfer]




BS5_A_3(3RUX)
?
[Raw transfer]




44J_B_4(4XTU)
?
[Raw transfer]




44R_B_5(4XU3)
?
[Raw transfer]




44O_B_6(4XU1)
?
[Raw transfer]




44L_B_4(4XTY)
?
[Raw transfer]




44M_B_5(4XTW)
?
[Raw transfer]




44O_A_3(4XU1)
?
[Raw transfer]




590_B_5(4XTX)
?
[Raw transfer]




44J_A_3(4XTU)
?
[Raw transfer]




44L_A_3(4XTY)
?
[Raw transfer]




BS5_B_4(3RUX)
?
[Raw transfer]




594_A_3(4XTZ)
?
[Raw transfer]




44N_A_3(4XU0)
?
[Raw transfer]




44Q_A_3(4XU2)
?
[Raw transfer]




590_A_3(4XTX)
?
[Raw transfer]




BT5_B_4(4OP0)
?
[Raw transfer]




BT5_A_3(4OP0)
?
[Raw transfer]




BTX_A_2(4WF2)
BIRA_ECOLI
[Raw transfer]




BTN_D_4(1HXD)
BIRA_ECOLI
[Raw transfer]




BTN_C_3(1HXD)
BIRA_ECOLI
[Raw transfer]




BTN_B_2(1BIB)
BIRA_ECOLI
[Raw transfer]




10 PsiBlast_PDB 89.4499%-117 - C5 -4XTZ 11.3 ?
8 PsiBlast_PDB 89.2099%-121 - C5 -4XTX 11.7 ?
24 PsiBlast_CBE 89.1599%-120 - C5 -4XU1 11.8 ?
48 HHSearch 88.96100%-117 - C5 -4XTV 11.9 ?
15 PsiBlast_PDB 88.8399%-115 - C5 -4XTU 11.8 ?
6 PsiBlast_PDB 88.7699%-117 - C5 -4XTV 11.9 ?
12 PsiBlast_PDB 88.6499%-120 - C5 -4XU1 11.7 ?
28 PsiBlast_CBE 88.6299%-119 - C5 -4XTX 11.6 ?
7 PsiBlast_PDB 88.5899%-114 - C5 -4XTW 11.4 ?
5 PsiBlast_PDB 88.5099%-116 - C5 -3RUX 12.0 ?
22 PsiBlast_CBE 88.4199%-114 - C5 -4XU3 10.9 ?
11 PsiBlast_PDB 88.3899%-117 - C5 -4XU0 11.8 ?
9 PsiBlast_PDB 88.1299%-115 - C5 -4XTY 11.7 ?
25 PsiBlast_CBE 87.9099%-112 - C5 -4XU0 11.8 ?
13 PsiBlast_PDB 87.9099%-117 - C5 -4XU2 11.4 ?
27 PsiBlast_CBE 87.8999%-117 - C5 -4XTY 11.6 ?
30 PsiBlast_CBE 87.8199%-117 - C5 -4XTV 11.7 ?
29 PsiBlast_CBE 87.7399%-117 - C5 -4XTW 11.2 ?
32 PsiBlast_CBE 87.5699%-116 - C5 -3RUX 11.8 ?
23 PsiBlast_CBE 87.0199%-115 - C5 -4XU2 11.3 ?
26 PsiBlast_CBE 86.9899%-114 - C5 -4XTZ 11.1 ?
31 PsiBlast_CBE 86.9699%-115 - C5 -4XTU 11.8 ?
14 PsiBlast_PDB 86.8599%-115 - C5 -4XU3 10.6 ?
21 PsiBlast_CBE 86.5399%-117 - C5 -4OP0 11.9 ?
4 PsiBlast_PDB 84.4599%-113 - C5 -4OP0 12.1 ?
17 PsiBlast_PDB 55.6933%-105 - C5 -4WF2 10.1 BIRA_ECOLI
18 PsiBlast_PDB 55.0333% -97 - C5 -1HXD 5.2 BIRA_ECOLI
35 PsiBlast_CBE 54.7133% -99 - C5 -1BIB 4.1 BIRA_ECOLI
34 PsiBlast_CBE 54.3133% -93 - C5 -1HXD 4.6 BIRA_ECOLI