@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3307: (2016-05-18 )
MADPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF

Atome Classification :

(73 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IMH_H_8(1G2O)
PUNA_MYCTU
[Raw transfer]




GNG_A_4(3IOM)
PUNA_MYCTU
[Raw transfer]




IMH_G_7(1G2O)
PUNA_MYCTU
[Raw transfer]




IMH_G_7(1G2O)
PUNA_MYCTU
[Raw transfer]




P1G_A_5(2AI1)
PNPH_BOVIN
[Raw transfer]




GNG_B_6(3IOM)
PUNA_MYCTU
[Raw transfer]




DIH_H_8(1N3I)
PUNA_MYCTU
[Raw transfer]




IMH_I_9(1G2O)
PUNA_MYCTU
[Raw transfer]




P1D_A_5(2AI2)
PNPH_BOVIN
[Raw transfer]




DIH_G_7(1N3I)
PUNA_MYCTU
[Raw transfer]




DIH_I_9(1N3I)
PUNA_MYCTU
[Raw transfer]




GMP_M_13(1RFG)
PNPH_HUMAN
[Raw transfer]




IMG_A_4(1B8N)
PNPH_BOVIN
[Raw transfer]




NOS_G_7(1A9S)
PNPH_BOVIN
[Raw transfer]




9DI_G_7(1A9P)
PNPH_BOVIN
[Raw transfer]




NOS_E_5(1RCT)
PNPH_HUMAN
[Raw transfer]




HPA_B_4(3SCZ)
PUNA_MYCTU
[Raw transfer]




HPA_A_3(3SCZ)
PUNA_MYCTU
[Raw transfer]




DIH_A_8(2P4S)
?
[Raw transfer]




DIH_M_13(1RSZ)
PNPH_HUMAN
[Raw transfer]




P2G_A_5(2AI3)
PNPH_BOVIN
[Raw transfer]




9HX_E_5(1I80)
PUNA_MYCTU
[Raw transfer]




DIH_J_10(2A0X)
PNPH_HUMAN
[Raw transfer]




IMH_A_4(1B8O)
PNPH_BOVIN
[Raw transfer]




IMH_M_13(1RT9)
PNPH_HUMAN
[Raw transfer]




9HX_G_7(1I80)
PUNA_MYCTU
[Raw transfer]




IMH_M_13(1RR6)
PNPH_HUMAN
[Raw transfer]




DIH_A_5(3BGS)
PNPH_HUMAN
[Raw transfer]




IMH_E_3(2Q7O)
PNPH_HUMAN
[Raw transfer]




22A_A_2(3K8Q)
PNPH_HUMAN
[Raw transfer]




9HX_F_6(1I80)
PUNA_MYCTU
[Raw transfer]




IMH_D_4(2ON6)
PNPH_HUMAN
[Raw transfer]




3DG_M_13(1V45)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(2OC4)
PNPH_HUMAN
[Raw transfer]




GUN_P_16(1V2H)
PNPH_HUMAN
[Raw transfer]




IMH_M_13(1PF7)
PNPH_HUMAN
[Raw transfer]




2DI_M_13(1V3Q)
PNPH_HUMAN
[Raw transfer]




HA1_A_4(1V48)
PNPH_BOVIN
[Raw transfer]




AC2_M_13(1PWY)
PNPH_HUMAN
[Raw transfer]




MSG_E_5(1YRY)
PNPH_HUMAN
[Raw transfer]




GUN_Q_17(1YQQ)
XAPA_ECOLI
[Raw transfer]




HPA_G_7(1A9R)
PNPH_BOVIN
[Raw transfer]




GUN_M_13(1YQQ)
XAPA_ECOLI
[Raw transfer]




HPA_A_4(1VFN)
PNPH_BOVIN
[Raw transfer]




HPA_G_7(1A9Q)
PNPH_BOVIN
[Raw transfer]




GUN_O_15(1YQU)
XAPA_ECOLI
[Raw transfer]




GUN_C_7(1VMK)
?
[Raw transfer]




GUN_O_15(1YQQ)
XAPA_ECOLI
[Raw transfer]




GUN_Q_17(1YQU)
XAPA_ECOLI
[Raw transfer]




GUN_M_13(1YQU)
XAPA_ECOLI
[Raw transfer]




8IG_B_9(1C3X)
PUNA_CELSP
[Raw transfer]




8IG_C_8(1C3X)
PUNA_CELSP
[Raw transfer]




GUN_J_10(1ULB)
PNPH_HUMAN
[Raw transfer]




8IG_A_10(1C3X)
PUNA_CELSP
[Raw transfer]




AZG_P_16(1V41)
PNPH_HUMAN
[Raw transfer]




7DG_A_5(3INY)
PNPH_HUMAN
[Raw transfer]




ADE_A_4(4LNA)
?
[Raw transfer]




ADE_A_4(4NSN)
?
[Raw transfer]




XAN_A_2(3ODG)
?
[Raw transfer]




GU7_A_5(1FXU)
PNPH_BOVIN
[Raw transfer]




XAN_A_2(3ODG)
?
[Raw transfer]




R1P_D_4(1A9T)
PNPH_BOVIN
[Raw transfer]




BTY_A_4(2QPL)
PNPH_BOVIN
[Raw transfer]




D1V_A_5(3D1V)
PNPH_HUMAN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_C_9(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_B_7(3FUC)
PNPH_BOVIN
[Raw transfer]




NDS_G_7(1TCV)
?
[Raw transfer]




HPA_A_2(4UC0)
?
[Raw transfer]




2 PsiBlast_PDB 98.70100%-120 - C5 -1I80 3.3 PUNA_MYCTU
22 PsiBlast_CBE 98.64100%-122 - C5 -3IOM 5.6 PUNA_MYCTU
5 PsiBlast_PDB 98.47100%-120 - C5 -3SCZ 3.6 PUNA_MYCTU
26 PsiBlast_CBE 98.29100%-122 - C5 -1I80 3.4 PUNA_MYCTU
21 PsiBlast_CBE 98.22100%-120 - C5 -3SCZ 3.6 PUNA_MYCTU
4 PsiBlast_PDB 98.14100%-121 - C5 -3IOM 5.4 PUNA_MYCTU
25 PsiBlast_CBE 97.69100%-122 - C5 -1I80 3.3 PUNA_MYCTU
23 PsiBlast_CBE 97.59100%-120 - C5 -1N3I 5.6 PUNA_MYCTU
27 PsiBlast_CBE 97.52100%-119 - C5 -1G2O 5.9 PUNA_MYCTU
28 PsiBlast_CBE 97.44100%-116 - C5 -1G2O 5.9 PUNA_MYCTU
24 PsiBlast_CBE 97.24100%-117 - C5 -1N3I 5.5 PUNA_MYCTU
3 PsiBlast_PDB 97.10100%-116 - C5 -1N3I 5.6 PUNA_MYCTU
112 HHSearch 96.68100%-118 - C5 -1G2O 6.1 PUNA_MYCTU
1 PsiBlast_PDB 96.68100%-118 - C5 -1G2O 6.1 PUNA_MYCTU
32 PsiBlast_CBE 81.5056%-104 - C5 -1C3X 4.5 PUNA_CELSP
30 PsiBlast_CBE 81.3056%-102 - C5 -1QE5 - PUNA_CELSP -
31 PsiBlast_CBE 81.0856%-103 - C5 -1C3X 3.7 PUNA_CELSP
7 PsiBlast_PDB 80.4456%-101 - C5 -1QE5 - PUNA_CELSP -
6 PsiBlast_PDB 80.1156%-101 - C5 -1C3X 4.5 PUNA_CELSP
29 PsiBlast_CBE 79.6456%-102 - C5 -1QE5 - PUNA_CELSP -
121 HHSearch 76.7035%-110 - C5 -3ODG 3.2 ?
122 HHSearch 76.1535%-105 - C5 -4LNA 3.3 ?
114 HHSearch 75.0638%-103 - C5 -3FUC 4.3 PNPH_BOVIN
120 HHSearch 75.0433%-100 - C5 -2P4S 5.0 ?
8 PsiBlast_PDB 75.0136%-105 - C5 -3ODG 3.2 ?
111 HHSearch 74.5535%-105 - C5 -4NSN 3.5 ?
15 PsiBlast_PDB 73.8538%-104 - C5 -1A9S 5.8 PNPH_BOVIN
10 PsiBlast_PDB 73.6138%-104 - C5 -1A9Q 3.1 PNPH_BOVIN
124 HHSearch 73.5835%-105 - C5 -1TCV 2.8 ?
11 PsiBlast_PDB 73.5038%-105 - C5 -1A9R 3.3 PNPH_BOVIN
12 PsiBlast_PDB 73.3438%-104 - C5 -1A9T 4.7 PNPH_BOVIN
47 PsiBlast_CBE 73.3338%-105 - C5 -1B8O 6.1 PNPH_BOVIN
48 PsiBlast_CBE 73.2738%-108 - C5 -1B8N 6.2 PNPH_BOVIN
14 PsiBlast_PDB 72.5438%-102 - C5 -1A9P 5.7 PNPH_BOVIN
9 PsiBlast_PDB 72.5138%-106 - C5 -1FXU 4.5 PNPH_BOVIN
91 PsiBlast_CBE 72.1038%-107 - C5 -1YQQ 3.4 XAPA_ECOLI
75 PsiBlast_CBE 71.9339%-111 - C5 -1V2H 3.6 PNPH_HUMAN
71 PsiBlast_CBE 71.8139%-108 - C5 -1PF7 3.3 PNPH_HUMAN
99 PsiBlast_CBE 71.7538%-111 - C5 -2A0X 4.2 PNPH_HUMAN
62 PsiBlast_CBE 71.6739%-110 - C5 -3D1V 2.9 PNPH_HUMAN
70 PsiBlast_CBE 71.5739%-111 - C5 -1RR6 5.1 PNPH_HUMAN
77 PsiBlast_CBE 71.4439%-111 - C5 -1RCT 4.7 PNPH_HUMAN
76 PsiBlast_CBE 71.4439%-113 - C5 -1RFG 4.0 PNPH_HUMAN
90 PsiBlast_CBE 71.3538%-108 - C5 -1YQQ 3.4 XAPA_ECOLI
64 PsiBlast_CBE 71.3039%-112 - C5 -2Q7O 4.3 PNPH_HUMAN
54 PsiBlast_CBE 71.3039%-111 - C5 -3K8Q 4.1 PNPH_HUMAN
74 PsiBlast_CBE 71.2739%-110 - C5 -1V3Q 4.1 PNPH_HUMAN
73 PsiBlast_CBE 71.2539%-112 - C5 -1V41 3.4 PNPH_HUMAN
45 PsiBlast_CBE 71.2538%-108 - C5 -3FUC 4.5 PNPH_BOVIN
51 PsiBlast_CBE 71.2338%-114 - C5 -2AI1 8.5 PNPH_BOVIN
44 PsiBlast_CBE 71.2238%-109 - C5 -3FUC 4.5 PNPH_BOVIN
46 PsiBlast_CBE 71.1938%-108 - C5 -3FUC 4.3 PNPH_BOVIN
89 PsiBlast_CBE 71.0838%-107 - C5 -1YQQ 3.4 XAPA_ECOLI
63 PsiBlast_CBE 71.0539%-107 - C5 -3BGS 4.5 PNPH_HUMAN
68 PsiBlast_CBE 71.0339%-110 - C5 -1RT9 5.5 PNPH_HUMAN
61 PsiBlast_CBE 70.9539%-113 - C5 -3INY 3.7 PNPH_HUMAN
72 PsiBlast_CBE 70.8539%-107 - C5 -1V45 4.0 PNPH_HUMAN
69 PsiBlast_CBE 70.8239%-109 - C5 -1RSZ 4.9 PNPH_HUMAN
50 PsiBlast_CBE 70.7238%-108 - C5 -2AI2 7.8 PNPH_BOVIN
100 PsiBlast_CBE 70.6639%-110 - C5 -2OC4 5.1 PNPH_HUMAN
65 PsiBlast_CBE 70.3539%-109 - C5 -1YRY 3.6 PNPH_HUMAN
78 PsiBlast_CBE 70.0639%-109 - C5 -1PWY 3.8 PNPH_HUMAN
53 PsiBlast_CBE 69.9438%-117 - C5 -2QPL 3.5 PNPH_BOVIN
98 PsiBlast_CBE 69.8638%-111 * C5 *2ON6 4.8 PNPH_HUMAN
49 PsiBlast_CBE 69.6438%-115 - C5 -2AI3 7.0 PNPH_BOVIN
33 PsiBlast_CBE 69.5839%-111 - C5 -1VMK 3.6 ?
20 PsiBlast_PDB 69.5438%-109 - C5 -1VFN 3.1 PNPH_BOVIN
66 PsiBlast_CBE 69.4639%-104 - C5 -1ULB 4.1 PNPH_HUMAN
52 PsiBlast_CBE 67.7038%-117 - C5 -1V48 7.2 PNPH_BOVIN
86 PsiBlast_CBE 64.3838%-116 - C5 -1YQU 4.2 XAPA_ECOLI
87 PsiBlast_CBE 64.1738%-117 - C5 -1YQU 3.2 XAPA_ECOLI
88 PsiBlast_CBE 64.1238%-116 - C5 -1YQU 4.2 XAPA_ECOLI
118 HHSearch 54.6239% -64 - C5 -4UC0 5.1 ?