@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3411c: (2016-05-19 )
MSRGMSGLEDSSDLVVSPYVRMGGLTTDPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDDGALVGIITNRDMRFEVDQSKQVAEVMTKAPLITAQEGVSASAALGLLRRNKIEKLPVVDGRGRLTGLITVKDFVKTEQHPLATKDSDGRLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGRGGATSYSKDRYFADDALSEDKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYYAR

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_3(4ZQM)
IMDH_MYCTU
[Raw transfer]




NAD_A_3(4ZQM)
IMDH_MYCTU
[Raw transfer]




NAD_B_8(4X3Z)
?
[Raw transfer]




IMP_A_2(4ZQP)
?
[Raw transfer]




IMP_A_2(1ZFJ)
IMDH_STRPY
[Raw transfer]




IMP_B_6(4FO4)
?
[Raw transfer]




IMP_U_21(1JR1)
IMDH2_CRIGR
[Raw transfer]




IMP_A_2(1ZFJ)
IMDH_STRPY
[Raw transfer]




IMP_A_2(4FXS)
?
[Raw transfer]




IMP_A_2(4FXS)
?
[Raw transfer]




IMP_A_3(5AHM)
?
[Raw transfer]




IMP_A_3(4FO4)
?
[Raw transfer]




IMP_A_2(4R7J)
?
[Raw transfer]




NAD_A_4(4X3Z)
?
[Raw transfer]




NAD_A_4(4X3Z)
?
[Raw transfer]




XMP_A_3(2CU0)
IMDH_PYRHO
[Raw transfer]




IMP_A_17(1JR1)
IMDH2_CRIGR
[Raw transfer]




XMP_A_3(2CU0)
IMDH_PYRHO
[Raw transfer]




IMP_D_11(4IX2)
?
[Raw transfer]




IMP_B_6(4IX2)
?
[Raw transfer]




Q21_B_18(4MY8)
?
[Raw transfer]




IMP_A_5(4IX2)
?
[Raw transfer]




NAJ_A_4(4QNE)
?
[Raw transfer]




4QO_A_3(4ZQN)
?
[Raw transfer]




IMP_C_8(4IX2)
?
[Raw transfer]




RVP_Y_25(1NF7)
IMDH2_HUMAN
[Raw transfer]




IMP_A_4(4AF0)
?
[Raw transfer]




Q21_B_13(4MY8)
?
[Raw transfer]




IMP_B_6(4AF0)
?
[Raw transfer]




NAJ_B_7(4QNE)
?
[Raw transfer]




RVP_A_4(1ME8)
IMDH_TRIFO
[Raw transfer]




FMT_A_7(4FEZ)
?
[Raw transfer]




KP3_A_3(4ZQP)
?
[Raw transfer]




FMT_B_12(4FEZ)
?
[Raw transfer]




XMP_A_2(4QQ3)
?
[Raw transfer]




39H_C_9(4QM1)
?
[Raw transfer]




39H_A_6(4QM1)
?
[Raw transfer]




Q67_A_3(4ZQO)
IMDH_MYCTU
[Raw transfer]




Q21_A_6(4MY8)
?
[Raw transfer]




XMP_A_3(3TSD)
?
[Raw transfer]




2EY_B_8(4MYA)
?
[Raw transfer]




2EY_A_4(4MYA)
?
[Raw transfer]




2EY_A_4(4MYA)
?
[Raw transfer]




39H_B_8(4QM1)
?
[Raw transfer]




CPR_A_9(1NFB)
IMDH2_HUMAN
[Raw transfer]




CPR_B_13(1NFB)
IMDH2_HUMAN
[Raw transfer]




39H_C_10(4QM1)
?
[Raw transfer]




IMP_A_3(3USB)
?
[Raw transfer]




IMP_A_3(3USB)
?
[Raw transfer]




MYD_U_21(1NF7)
IMDH2_HUMAN
[Raw transfer]




IMP_A_2(5AHN)
?
[Raw transfer]




IMP_A_2(5AHN)
?
[Raw transfer]




121 HHSearch 84.3955% -93 - C2 -4FXS 6.8 ?
6 PsiBlast_PDB 84.3254% -87 - C2 -3TSB - ? -
10 PsiBlast_PDB 83.5552% -93 - C2 -4FXS 6.8 ?
125 HHSearch 83.2397%-108 - C2 -4ZQM 6.4 IMDH_MYCTU
117 HHSearch 81.8552% -87 - C2 -1ZFJ 6.4 IMDH_STRPY
11 PsiBlast_PDB 81.0350% -87 - C2 -1ZFJ 6.4 IMDH_STRPY
7 PsiBlast_PDB 79.3954% -95 - C2 -3TSD 6.3 ?
115 HHSearch 78.2155% -98 - C2 -3USB 4.7 ?
9 PsiBlast_PDB 77.3452% -98 - C2 -3USB 4.7 ?
14 PsiBlast_PDB 76.8654%-106 - C2 -4DQW - ? -
26 PsiBlast_CBE 76.7343% -93 - C2 -4Z87 - ? -
25 PsiBlast_CBE 76.7243% -94 - C2 -4Z87 - ? -
30 PsiBlast_CBE 75.9541% -95 - C2 -1NF7 5.1 IMDH2_HUMAN
20 PsiBlast_PDB 75.8341% -93 - C2 -1NF7 4.5 IMDH2_HUMAN
4 PsiBlast_PDB 74.8382% -95 - C2 -4ZQP 8.1 ?
23 PsiBlast_CBE 74.6882% -91 - C2 -4ZQR - ? -
24 PsiBlast_CBE 74.5154%-110 - C2 -4DQW - ? -
5 PsiBlast_PDB 74.4982% -91 - C2 -4ZQR - IMDH_MYCTU -
3 PsiBlast_PDB 74.4682% -94 - C2 -4ZQO 5.2 IMDH_MYCTU
21 PsiBlast_CBE 74.3882% -91 - C2 -4ZQR - ? -
2 PsiBlast_PDB 73.8882% -93 - C2 -4ZQN 5.2 ?
18 PsiBlast_PDB 73.8141% -94 - C2 -1JR1 6.2 IMDH2_CRIGR
1 PsiBlast_PDB 72.2982%-100 - C2 -4ZQM 6.4 IMDH_MYCTU
16 PsiBlast_PDB 71.8050% -86 - C2 -2CU0 6.8 IMDH_PYRHO
120 HHSearch 71.3751% -86 - C2 -2CU0 6.8 IMDH_PYRHO
29 PsiBlast_CBE 70.1241% -97 - C2 -1NFB 5.5 IMDH2_HUMAN
28 PsiBlast_CBE 70.0941% -96 - C2 -1NFB 5.4 IMDH2_HUMAN
27 PsiBlast_CBE 68.2141% -91 - C2 -1JR1 6.1 IMDH2_CRIGR
118 HHSearch 67.4355%-105 - C2 -5AHN 5.1 ?
15 PsiBlast_PDB 67.1554%-105 - C2 -5AHN 5.1 ?
84 PsiBlast_CBE 66.4838% -85 - C2 -4AF0 7.0 ?
119 HHSearch 64.9232% -87 - C2 -1ME8 6.6 IMDH_TRIFO
85 PsiBlast_CBE 64.6638% -86 - C2 -4AF0 7.1 ?
82 PsiBlast_CBE 62.9261% -98 - C2 -5AHM 6.4 ?
81 PsiBlast_CBE 60.4857% -97 - C2 -4FO4 6.0 ?
80 PsiBlast_CBE 60.4357% -97 - C2 -4FO4 6.3 ?
132 HHSearch 60.1562% -95 - C2 -4R7J 6.5 ?
71 PsiBlast_CBE 60.1457% -97 - C2 -4X3Z 4.9 ?
72 PsiBlast_CBE 60.0557% -96 - C2 -4X3Z 5.6 ?
49 PsiBlast_CBE 60.0357%-102 - C2 -4MYA 5.2 ?
61 PsiBlast_CBE 60.0257%-104 - C2 -4MY8 5.3 ?
39 PsiBlast_CBE 59.8357%-105 - C2 -4QM1 4.9 ?
50 PsiBlast_CBE 59.7757% -99 - C2 -4MYA 5.1 ?
76 PsiBlast_CBE 59.7357%-100 - C2 -4IX2 5.5 ?
75 PsiBlast_CBE 59.4257% -94 - C2 -4QNE 4.9 ?
62 PsiBlast_CBE 59.3757%-101 - C2 -4MY8 5.2 ?
74 PsiBlast_CBE 59.2357% -97 - C2 -4QNE 5.6 ?
60 PsiBlast_CBE 59.2157%-107 - C2 -4MY8 5.3 ?
77 PsiBlast_CBE 59.1457% -99 - C2 -4IX2 6.1 ?
35 PsiBlast_CBE 59.0853% -92 - C2 -4FEZ 3.1 ?
79 PsiBlast_CBE 58.9857% -97 - C2 -4IX2 5.3 ?
78 PsiBlast_CBE 58.6057% -93 - C2 -4IX2 4.4 ?
40 PsiBlast_CBE 58.5457%-103 - C2 -4QM1 4.9 ?
37 PsiBlast_CBE 58.4257% -99 - C2 -4QM1 4.5 ?
129 HHSearch 58.1359% -92 - C2 -4X3Z 5.5 ?
38 PsiBlast_CBE 57.8957%-104 - C2 -4QM1 4.5 ?
36 PsiBlast_CBE 57.7553% -93 - C2 -4FEZ 3.2 ?
130 HHSearch 56.9858% -93 - C2 -4MYA 5.1 ?
73 PsiBlast_CBE 56.9357%-112 - C2 -4QQ3 6.9 ?