@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3545c: (2016-05-20 )
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_A_2(3IW0)
CP125_MYCTU
[Raw transfer]




HEM_A_2(2XC3)
CP125_MYCTU
[Raw transfer]




HEM_A_2(2X5L)
CP125_MYCTU
[Raw transfer]




HEM_A_3(3IW1)
CP125_MYCTU
[Raw transfer]




HEM_A_3(2XN8)
CP125_MYCTU
[Raw transfer]




HEM_A_2(3IVY)
CP125_MYCTU
[Raw transfer]




HEM_A_2(3IVY)
CP125_MYCTU
[Raw transfer]




HEM_A_3(3IW2)
CP125_MYCTU
[Raw transfer]




HEM_A_2(5DQN)
?
[Raw transfer]




HEM_A_5(2X5W)
CP125_MYCTU
[Raw transfer]




HEM_A_4(4APY)
?
[Raw transfer]




HEM_A_2(2WM5)
CP124_MYCTU
[Raw transfer]




HEM_A_2(2WM5)
CP124_MYCTU
[Raw transfer]




HEM_A_2(2WM4)
CP124_MYCTU
[Raw transfer]




HEM_B_16(3ZPI)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2BVJ)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(4UMZ)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(2VZM)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(3ZPI)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(4UMZ)
PIKC_STRVZ
[Raw transfer]




HEM_B_17(4B7S)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2VZM)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(3ZK5)
PIKC_STRVZ
[Raw transfer]




HEM_B_6(2BVJ)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2VZ7)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(2VZ7)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(4B7S)
PIKC_STRVZ
[Raw transfer]




EDO_A_9(4APY)
?
[Raw transfer]




HEM_A_3(2C6H)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(2C7X)
PIKC_STRVZ
[Raw transfer]




HEM_B_7(4B7D)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(3ZK5)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2CA0)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2WI9)
PIKC_STRVZ
[Raw transfer]




HEM_B_9(2C6H)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(2CA0)
PIKC_STRVZ
[Raw transfer]




HEM_B_5(2WI9)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2WHW)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(3A4G)
CPVDH_PSEAH
[Raw transfer]




HEM_B_5(2WHW)
PIKC_STRVZ
[Raw transfer]




HEM_A_3(2CD8)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(3A4H)
CPVDH_PSEAH
[Raw transfer]




HEM_B_5(2CD8)
PIKC_STRVZ
[Raw transfer]




1PE_A_6(5DQN)
?
[Raw transfer]




HEM_A_4(4B7D)
PIKC_STRVZ
[Raw transfer]




HEM_A_2(3WVS)
?
[Raw transfer]




HEM_A_2(3VRM)
CPVDH_PSEAH
[Raw transfer]




FMT_A_4(3ZPI)
PIKC_STRVZ
[Raw transfer]




EDO_A_7(4APY)
?
[Raw transfer]




GOL_A_7(3WVS)
?
[Raw transfer]




1 PsiBlast_PDB 92.97100% -94 - C4 -2X5W 13.1 CP125_MYCTU
6 PsiBlast_PDB 91.9999% -94 - C4 -2X5L 13.1 CP125_MYCTU
3 PsiBlast_PDB 90.81100% -93 - C4 -3IW0 13.0 CP125_MYCTU
8 PsiBlast_PDB 90.6999% -98 - C4 -2XN8 13.1 CP125_MYCTU
7 PsiBlast_PDB 90.6499% -95 - C4 -2XC3 13.1 CP125_MYCTU
2 PsiBlast_PDB 90.33100% -94 - C4 -3IVY 13.0 CP125_MYCTU
4 PsiBlast_PDB 89.53100% -96 - C4 -3IW1 13.0 CP125_MYCTU
110 HHSearch 89.1998% -94 - C4 -3IVY 13.0 CP125_MYCTU
5 PsiBlast_PDB 88.40100% -95 - C4 -3IW2 13.3 CP125_MYCTU
10 PsiBlast_PDB 85.4375% -92 - C4 -4APY 13.2 ?
9 PsiBlast_PDB 84.9975% -89 - C4 -5DQN 12.5 ?
13 PsiBlast_PDB 70.2830% -89 - C4 -4L0E - ? -
15 PsiBlast_PDB 70.2030% -82 - C4 -4PWV - ? -
11 PsiBlast_PDB 69.9442% -81 - C4 -2WM4 12.0 CP124_MYCTU
14 PsiBlast_PDB 67.5130% -83 - C4 -4PXH - ? -
12 PsiBlast_PDB 67.2542% -81 - C4 -2WM5 12.2 CP124_MYCTU
116 HHSearch 66.4239% -78 - C4 -2WM5 12.2 CP124_MYCTU
16 PsiBlast_PDB 64.7430% -93 - C4 -4RM4 - YJIB_BACSU -
114 HHSearch 64.6528% -89 - C4 -3TKT - ? -
30 PsiBlast_CBE 62.8532% -91 - C4 -3RWL - ? -
109 PsiBlast_CBE 61.3133%-103 - C4 -3WVS 12.5 ?
53 PsiBlast_CBE 60.3134% -95 - C4 -2WHW 13.1 PIKC_STRVZ
83 PsiBlast_CBE 60.0034% -97 - C4 -4B7D 13.1 PIKC_STRVZ
77 PsiBlast_CBE 59.9834% -96 - C4 -3ZK5 12.8 PIKC_STRVZ
54 PsiBlast_CBE 59.9534% -99 - C4 -2WHW 13.0 PIKC_STRVZ
86 PsiBlast_CBE 59.9434%-102 - C4 -2CD8 12.8 PIKC_STRVZ
91 PsiBlast_CBE 59.7734% -97 - C4 -2C6H 13.1 PIKC_STRVZ
80 PsiBlast_CBE 59.6734% -95 - C4 -2VZM 12.9 PIKC_STRVZ
75 PsiBlast_CBE 59.3234% -95 - C4 -3ZPI 12.8 PIKC_STRVZ
74 PsiBlast_CBE 59.2834% -97 - C4 -4B7S 13.1 PIKC_STRVZ
93 PsiBlast_CBE 59.1134% -94 - C4 -2BVJ 13.1 PIKC_STRVZ
89 PsiBlast_CBE 58.9334% -96 - C4 -2C7X 12.8 PIKC_STRVZ
82 PsiBlast_CBE 58.7534% -95 - C4 -2VZ7 13.2 PIKC_STRVZ
56 PsiBlast_CBE 58.7334% -95 - C4 -4UMZ 13.0 PIKC_STRVZ
90 PsiBlast_CBE 58.7134% -98 - C4 -2C6H 13.2 PIKC_STRVZ
78 PsiBlast_CBE 58.6934% -96 - C4 -3ZK5 12.7 PIKC_STRVZ
79 PsiBlast_CBE 58.5334% -97 - C4 -2VZM 13.0 PIKC_STRVZ
92 PsiBlast_CBE 58.5234% -94 - C4 -2BVJ 13.2 PIKC_STRVZ
73 PsiBlast_CBE 58.5134% -97 - C4 -4B7S 13.0 PIKC_STRVZ
76 PsiBlast_CBE 58.1334% -96 - C4 -3ZPI 13.0 PIKC_STRVZ
52 PsiBlast_CBE 57.9634% -96 - C4 -2WI9 13.3 PIKC_STRVZ
84 PsiBlast_CBE 57.7534% -95 - C4 -4B7D 12.6 PIKC_STRVZ
55 PsiBlast_CBE 57.6734% -96 - C4 -4UMZ 12.9 PIKC_STRVZ
85 PsiBlast_CBE 57.4134% -98 - C4 -2CD8 13.3 PIKC_STRVZ
51 PsiBlast_CBE 57.4034% -94 - C4 -2WI9 13.2 PIKC_STRVZ
81 PsiBlast_CBE 56.8934% -95 - C4 -2VZ7 12.8 PIKC_STRVZ
88 PsiBlast_CBE 56.8034% -97 - C4 -2CA0 12.1 PIKC_STRVZ
87 PsiBlast_CBE 56.2334% -92 - C4 -2CA0 12.6 PIKC_STRVZ
49 PsiBlast_CBE 52.9032% -74 - C4 -3A4H 11.8 CPVDH_PSEAH
50 PsiBlast_CBE 52.7332% -75 - C4 -3A4G 12.3 CPVDH_PSEAH
94 PsiBlast_CBE 51.7032% -77 - C4 -3VRM 11.6 CPVDH_PSEAH