@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3581c: (2016-05-21 )
MNQLPRVGLGTDVHPIEPGRPCWLVGLLFPSADGCAGHSDGDVAVHALCDAVLSAAGLGDIGEVFGVDDPRWQGVSGADMLRHVVVLITQHGYRVGNAVVQVIGNRPKIGWRRLEAQAVLSRLLNAPVSVSATTTDGLGLTGRGEGLAAIATALVVSLR

Atome Classification :

(81 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUD_D_4(1U43)
ISPF_ECOLI
[Raw transfer]




CTP_B_6(3IEW)
ISPF_BURPS
[Raw transfer]




1AA_C_15(2AMT)
ISPF_ECOLI
[Raw transfer]




CDP_A_5(2UZH)
?
[Raw transfer]




AO9_A_9(3Q8H)
ISPF_BURPS
[Raw transfer]




CDP_B_9(2UZH)
?
[Raw transfer]




CDM_A_3(1U40)
ISPF_ECOLI
[Raw transfer]




1AA_E_17(2AMT)
ISPF_ECOLI
[Raw transfer]




AO9_A_5(3Q8H)
ISPF_BURPS
[Raw transfer]




829_A_5(3KE1)
ISPF_BURP1
[Raw transfer]




CDP_C_15(2UZH)
?
[Raw transfer]




AO9_B_11(3Q8H)
ISPF_BURPS
[Raw transfer]




829_C_10(3KE1)
ISPF_BURP1
[Raw transfer]




1AA_A_13(2AMT)
ISPF_ECOLI
[Raw transfer]




829_B_8(3KE1)
ISPF_BURP1
[Raw transfer]




1AA_E_18(2AMT)
ISPF_ECOLI
[Raw transfer]




CDP_B_20(1IV2)
ISPF_THET8
[Raw transfer]




CDP_E_24(1IV2)
ISPF_THET8
[Raw transfer]




CDP_A_19(1IV2)
ISPF_THET8
[Raw transfer]




1AA_D_19(2AMT)
ISPF_ECOLI
[Raw transfer]




CDP_D_22(1IV2)
ISPF_THET8
[Raw transfer]




1AA_C_14(2AMT)
ISPF_ECOLI
[Raw transfer]




CDP_B_21(1IV2)
ISPF_THET8
[Raw transfer]




CDP_E_23(1IV2)
ISPF_THET8
[Raw transfer]




CDP_C_9(3IEW)
ISPF_BURPS
[Raw transfer]




CDP_A_4(1YQN)
ISPF_ECOLI
[Raw transfer]




CDP_A_4(1U3L)
ISPF_ECOLI
[Raw transfer]




C_A_3(1W55)
ISPDF_CAMJE
[Raw transfer]




C5P_D_23(1IV4)
ISPF_THET8
[Raw transfer]




C5P_F_24(1IV4)
ISPF_THET8
[Raw transfer]




C5P_F_22(1IV4)
ISPF_THET8
[Raw transfer]




C5P_C_19(1IV4)
ISPF_THET8
[Raw transfer]




C5P_A_20(1IV4)
ISPF_THET8
[Raw transfer]




C5P_B_21(1IV4)
ISPF_THET8
[Raw transfer]




C5P_A_5(2PMP)
ISPF_ARATH
[Raw transfer]




C5P_E_14(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_C_10(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_A_5(2PMP)
ISPF_ARATH
[Raw transfer]




I5A_B_9(3K2X)
ISPF_BURP1
[Raw transfer]




C5P_B_8(4C8E)
ISPF_BURCJ
[Raw transfer]




C5P_C_8(3F0F)
ISPF_BURP1
[Raw transfer]




CTN_B_11(3QHD)
ISPF_BURP1
[Raw transfer]




C5P_B_8(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_F_16(3F0G)
ISPF_BURP1
[Raw transfer]




CTN_B_9(3P0Z)
ISPF_BURP1
[Raw transfer]




CTN_B_9(3P10)
ISPF_BURP1
[Raw transfer]




CDP_A_5(3IEW)
ISPF_BURPS
[Raw transfer]




C5P_D_12(3F0G)
ISPF_BURP1
[Raw transfer]




C_B_8(3IEQ)
ISPF_BURP1
[Raw transfer]




CTN_A_7(3P0Z)
ISPF_BURP1
[Raw transfer]




CTN_A_6(3P10)
ISPF_BURP1
[Raw transfer]




I5A_C_11(3K2X)
ISPF_BURP1
[Raw transfer]




CDP_A_4(4C81)
ISPF_PLAF7
[Raw transfer]




I5A_A_5(3K2X)
ISPF_BURP1
[Raw transfer]




CTN_C_12(3P10)
ISPF_BURP1
[Raw transfer]




C5P_A_3(1JY8)
ISPF_ECOLI
[Raw transfer]




CTN_C_13(3QHD)
ISPF_BURP1
[Raw transfer]




C_C_10(3IEQ)
ISPF_BURP1
[Raw transfer]




CTN_C_12(3P0Z)
ISPF_BURP1
[Raw transfer]




C5P_C_14(5B8F)
ISPF_PSEAE
[Raw transfer]




CTN_A_6(3QHD)
ISPF_BURP1
[Raw transfer]




C_A_4(3IEQ)
ISPF_BURP1
[Raw transfer]




C5P_A_3(1JY8)
ISPF_ECOLI
[Raw transfer]




C5P_C_14(5B8F)
ISPF_PSEAE
[Raw transfer]




C5P_A_5(5B8F)
ISPF_PSEAE
[Raw transfer]




535_A_5(3K14)
ISPF_BURP1
[Raw transfer]




HHV_C_10(3JVH)
ISPF_BURP1
[Raw transfer]




535_C_11(3K14)
ISPF_BURP1
[Raw transfer]




C5P_B_8(5B8F)
ISPF_PSEAE
[Raw transfer]




HHV_A_5(3JVH)
ISPF_BURP1
[Raw transfer]




HHV_B_8(3JVH)
ISPF_BURP1
[Raw transfer]




717_A_6(3MBM)
ISPF_BURP1
[Raw transfer]




717_A_5(3IKF)
ISPF_BURPS
[Raw transfer]




717_C_11(3MBM)
ISPF_BURP1
[Raw transfer]




717_A_6(3IKF)
ISPF_BURPS
[Raw transfer]




717_B_10(3MBM)
ISPF_BURP1
[Raw transfer]




717_B_10(3IKF)
ISPF_BURPS
[Raw transfer]




114 HHSearch 97.2675%-147 - C11 -2UZH 3.4 ?
21 PsiBlast_CBE 93.2875%-140 - C11 -2UZH 3.8 ?
1 PsiBlast_PDB 93.1375%-144 - C11 -2UZH - ? -
22 PsiBlast_CBE 92.3575%-143 - C11 -2UZH 3.5 ?
43 PsiBlast_CBE 85.5840%-140 - C11 -3Q8H 3.6 ISPF_BURPS
11 PsiBlast_PDB 85.5640%-144 - C11 -3IEQ 3.4 ISPF_BURP1
12 PsiBlast_PDB 85.4840%-142 - C11 -3IEW 2.9 ISPF_BURPS
13 PsiBlast_PDB 85.2840%-144 - C11 -3JVH 2.7 ISPF_BURP1
79 PsiBlast_CBE 85.2740%-145 - C11 -3IKF 4.2 ISPF_BURPS
14 PsiBlast_PDB 85.2240%-144 - C11 -3K14 2.9 ISPF_BURP1
10 PsiBlast_PDB 84.9340%-143 - C11 -3F0G 3.2 ISPF_BURP1
8 PsiBlast_PDB 84.9040%-141 - C11 -3F0E - ISPF_BURP1 -
17 PsiBlast_PDB 84.8340%-143 - C11 -3MBM 4.1 ISPF_BURP1
82 PsiBlast_CBE 84.8240%-143 - C11 -3IKE - ISPF_BURPS -
40 PsiBlast_CBE 84.6240%-140 - C11 -3QHD 3.4 ISPF_BURP1
46 PsiBlast_CBE 84.2440%-142 - C11 -3P10 3.5 ISPF_BURP1
42 PsiBlast_CBE 84.1440%-142 - C11 -3QHD 3.5 ISPF_BURP1
65 PsiBlast_CBE 84.1040%-135 - C11 -3F0G 3.1 ISPF_BURP1
9 PsiBlast_PDB 83.9840%-139 - C11 -3F0F - ISPF_BURP1 -
69 PsiBlast_CBE 83.9040%-136 - C11 -3F0F 3.2 ISPF_BURP1
15 PsiBlast_PDB 83.7140%-145 - C11 -3K2X 3.3 ISPF_BURP1
19 PsiBlast_PDB 83.7040%-143 - C11 -3P10 3.3 ISPF_BURP1
44 PsiBlast_CBE 83.6840%-142 - C11 -3Q8H 3.3 ISPF_BURPS
18 PsiBlast_PDB 83.2840%-143 - C11 -3P0Z 3.2 ISPF_BURP1
115 HHSearch 83.0842%-137 - C11 -5B8F 3.2 ISPF_PSEAE
47 PsiBlast_CBE 83.0140%-145 - C11 -3P0Z 3.2 ISPF_BURP1
57 PsiBlast_CBE 82.9740%-144 - C11 -3JVH 3.1 ISPF_BURP1
92 PsiBlast_CBE 82.7741%-136 - C11 -2AMT 3.4 ISPF_ECOLI
2 PsiBlast_PDB 82.7441%-139 - C11 -5B8F 3.2 ISPF_PSEAE
117 HHSearch 82.6137%-138 - C11 -4C8E 3.2 ISPF_BURCJ
111 HHSearch 82.5337%-131 - C11 -2PMP 3.4 ISPF_ARATH
83 PsiBlast_CBE 82.4236%-136 - C11 -2PMP 3.4 ISPF_ARATH
45 PsiBlast_CBE 82.2940%-143 - C11 -3P10 3.2 ISPF_BURP1
94 PsiBlast_CBE 82.1641%-137 - C11 -1U40 2.6 ISPF_ECOLI
23 PsiBlast_CBE 82.1641%-141 - C11 -5B8F 2.9 ISPF_PSEAE
88 PsiBlast_CBE 82.1441%-135 - C11 -2AMT 3.6 ISPF_ECOLI
90 PsiBlast_CBE 81.9141%-135 - C11 -2AMT 4.5 ISPF_ECOLI
59 PsiBlast_CBE 81.7940%-144 - C11 -3IEW 3.1 ISPF_BURPS
24 PsiBlast_CBE 81.6341%-137 - C11 -5B8F 3.2 ISPF_PSEAE
93 PsiBlast_CBE 81.6041%-137 - C11 -1U43 2.8 ISPF_ECOLI
16 PsiBlast_PDB 81.5940%-145 - C11 -3KE1 3.2 ISPF_BURP1
96 PsiBlast_CBE 81.5841%-139 - C11 -1U3L 3.9 ISPF_ECOLI
67 PsiBlast_CBE 81.5840%-143 - C11 -3F0G 3.1 ISPF_BURP1
102 Fugue 81.5342%-142 - C11 -1JY8 3.4 ISPF_ECOLI
48 PsiBlast_CBE 81.5340%-142 - C11 -3P0Z 3.5 ISPF_BURP1
20 PsiBlast_PDB 81.4240%-148 - C11 -3Q8H 3.4 ISPF_BURPS
50 PsiBlast_CBE 81.3640%-138 - C11 -3MBM 2.9 ISPF_BURP1
87 PsiBlast_CBE 81.2741%-134 - C11 -2AMT 2.9 ISPF_ECOLI
62 PsiBlast_CBE 81.2740%-144 - C11 -3IEQ 3.4 ISPF_BURP1
49 PsiBlast_CBE 81.2340%-140 - C11 -3MBM 2.3 ISPF_BURP1
98 PsiBlast_CBE 81.2241%-142 - C11 -1JY8 3.4 ISPF_ECOLI
41 PsiBlast_CBE 80.9440%-141 - C11 -3QHD 3.5 ISPF_BURP1
89 PsiBlast_CBE 80.8841%-132 - C11 -2AMT 4.0 ISPF_ECOLI
91 PsiBlast_CBE 80.8041%-140 - C11 -2AMT 2.4 ISPF_ECOLI
54 PsiBlast_CBE 80.7340%-144 - C11 -3K2X 3.8 ISPF_BURP1
61 PsiBlast_CBE 80.6140%-143 - C11 -3IEQ 3.2 ISPF_BURP1
60 PsiBlast_CBE 80.5540%-146 - C11 -3IEW 3.8 ISPF_BURPS
58 PsiBlast_CBE 80.5240%-141 - C11 -3JVH 3.1 ISPF_BURP1
55 PsiBlast_CBE 80.3740%-140 - C11 -3K14 3.4 ISPF_BURP1
78 PsiBlast_CBE 80.3440%-147 - C11 -3IKF 2.5 ISPF_BURPS
63 PsiBlast_CBE 80.3140%-140 - C11 -3F0G 2.7 ISPF_BURP1
77 PsiBlast_CBE 80.2340%-145 - C11 -3IKF 3.1 ISPF_BURPS
121 HHSearch 80.1933%-136 - C11 -1W55 3.5 ISPDF_CAMJE
112 HHSearch 79.8340%-131 - C11 -1YQN 3.4 ISPF_ECOLI
53 PsiBlast_CBE 79.1640%-146 - C11 -3K2X 3.3 ISPF_BURP1
64 PsiBlast_CBE 79.0240%-140 - C11 -3F0G 3.1 ISPF_BURP1
52 PsiBlast_CBE 78.7440%-145 - C11 -3KE1 3.1 ISPF_BURP1
51 PsiBlast_CBE 78.5540%-148 - C11 -3KE1 2.8 ISPF_BURP1
28 PsiBlast_CBE 78.2045%-135 - C11 -1IV4 3.4 ISPF_THET8
27 PsiBlast_CBE 78.0745%-139 - C11 -1IV4 3.4 ISPF_THET8
6 PsiBlast_PDB 77.9945%-133 - C11 -1IV4 3.5 ISPF_THET8
38 PsiBlast_CBE 77.9845%-132 - C11 -1IV2 3.7 ISPF_THET8
36 PsiBlast_CBE 77.9545%-136 - C11 -1IV2 3.5 ISPF_THET8
39 PsiBlast_CBE 77.9445%-136 - C11 -1IV2 3.8 ISPF_THET8
37 PsiBlast_CBE 77.9245%-135 - C11 -1IV2 3.9 ISPF_THET8
25 PsiBlast_CBE 77.9245%-138 - C11 -1IV4 3.4 ISPF_THET8
4 PsiBlast_PDB 77.8245%-132 - C11 -1IV2 3.8 ISPF_THET8
35 PsiBlast_CBE 77.5545%-135 - C11 -1IV2 3.9 ISPF_THET8
26 PsiBlast_CBE 77.3245%-136 - C11 -1IV4 3.5 ISPF_THET8
29 PsiBlast_CBE 77.0145%-135 - C11 -1IV4 3.5 ISPF_THET8
120 HHSearch 75.4931%-137 - C11 -4C81 3.3 ISPF_PLAF7