@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3602c: (2016-05-21 )
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN

Atome Classification :

(105 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2DQ_A_7(4MUI)
PANC_MYCTO
[Raw transfer]




FG6_A_3(3IVX)
PANC_MYCTU
[Raw transfer]




2DW_A_6(4MUL)
PANC_MYCTO
[Raw transfer]




29W_A_6(4MQ6)
PANC_MYCTO
[Raw transfer]




2DJ_A_5(4MUF)
PANC_MYCTO
[Raw transfer]




2DU_A_6(4MUJ)
PANC_MYCTO
[Raw transfer]




2DQ_B_10(4MUI)
PANC_MYCTO
[Raw transfer]




2DW_B_13(4MUL)
PANC_MYCTO
[Raw transfer]




GOL_B_14(3COV)
PANC_MYCTU
[Raw transfer]




PAJ_A_6(1N2I)
PANC_MYCTU
[Raw transfer]




GOL_B_7(1MOP)
PANC_MYCTU
[Raw transfer]




ATP_A_3(4G5Y)
PANC_MYCTU
[Raw transfer]




APC_B_7(1N2B)
PANC_MYCTU
[Raw transfer]




FG3_A_3(3IUE)
PANC_MYCTU
[Raw transfer]




ATP_B_9(4G5Y)
PANC_MYCTU
[Raw transfer]




APC_A_6(1N2B)
PANC_MYCTU
[Raw transfer]




FG5_B_16(3IVG)
PANC_MYCTU
[Raw transfer]




APC_B_7(1N2E)
PANC_MYCTU
[Raw transfer]




APC_A_7(1N2G)
PANC_MYCTU
[Raw transfer]




2B5_B_11(3LE8)
PANC_MYCTU
[Raw transfer]




APC_A_6(1N2E)
PANC_MYCTU
[Raw transfer]




APC_B_8(1N2G)
PANC_MYCTU
[Raw transfer]




FG6_B_14(3IVX)
PANC_MYCTU
[Raw transfer]




FG4_A_3(3IVC)
PANC_MYCTU
[Raw transfer]




PAJ_B_7(1N2I)
PANC_MYCTU
[Raw transfer]




2DV_A_3(4MUK)
PANC_MYCTO
[Raw transfer]




2DN_B_11(4MUH)
PANC_MYCTO
[Raw transfer]




2DJ_B_6(4MUF)
PANC_MYCTO
[Raw transfer]




29W_B_14(4MQ6)
PANC_MYCTO
[Raw transfer]




PAJ_A_7(1N2H)
PANC_MYCTU
[Raw transfer]




52H_B_4(3COW)
PANC_MYCTU
[Raw transfer]




PAJ_B_8(1N2H)
PANC_MYCTU
[Raw transfer]




ATP_A_4(2A84)
PANC_MYCTU
[Raw transfer]




GOL_A_3(3IVG)
PANC_MYCTU
[Raw transfer]




GOL_A_9(1MOP)
PANC_MYCTU
[Raw transfer]




2DU_B_11(4MUJ)
PANC_MYCTO
[Raw transfer]




2DZ_B_15(4MUN)
PANC_MYCTO
[Raw transfer]




53H_B_4(3COY)
PANC_MYCTU
[Raw transfer]




A7D_A_3(3IOE)
PANC_MYCTU
[Raw transfer]




52H_A_3(3COW)
PANC_MYCTU
[Raw transfer]




2DN_A_5(4MUH)
PANC_MYCTO
[Raw transfer]




54H_A_5(3COZ)
PANC_MYCTU
[Raw transfer]




PAJ_A_3(3AG6)
PANC_STAA8
[Raw transfer]




GOL_A_7(3COV)
PANC_MYCTU
[Raw transfer]




GOL_A_7(3COV)
PANC_MYCTU
[Raw transfer]




2DK_A_7(4MUG)
PANC_MYCTO
[Raw transfer]




A5D_A_5(3IOC)
PANC_MYCTU
[Raw transfer]




A6D_A_3(3IOD)
PANC_MYCTU
[Raw transfer]




2DV_B_12(4MUK)
PANC_MYCTO
[Raw transfer]




AMP_B_5(2A86)
PANC_MYCTU
[Raw transfer]




AMP_A_4(2A86)
PANC_MYCTU
[Raw transfer]




AMP_A_3(2A7X)
PANC_MYCTU
[Raw transfer]




A7D_B_9(3IOE)
PANC_MYCTU
[Raw transfer]




2DH_A_3(4MUE)
PANC_MYCTO
[Raw transfer]




2DK_B_11(4MUG)
PANC_MYCTO
[Raw transfer]




ATP_C_9(3INN)
PANC_BRUME
[Raw transfer]




A6D_B_9(3IOD)
PANC_MYCTU
[Raw transfer]




FG2_B_19(3IUB)
PANC_MYCTU
[Raw transfer]




FG3_B_18(3IUE)
PANC_MYCTU
[Raw transfer]




2DH_B_7(4MUE)
PANC_MYCTO
[Raw transfer]




FG2_A_10(3IUB)
PANC_MYCTU
[Raw transfer]




A5D_B_6(3IOC)
PANC_MYCTU
[Raw transfer]




ATP_A_5(3INN)
PANC_BRUME
[Raw transfer]




A4D_B_10(3IOB)
PANC_MYCTU
[Raw transfer]




A4D_A_3(3IOB)
PANC_MYCTU
[Raw transfer]




GOL_B_10(1V8F)
PANC_THET8
[Raw transfer]




ATP_D_13(3INN)
PANC_BRUME
[Raw transfer]




GOL_A_6(3MXT)
PANC_CAMJE
[Raw transfer]




A8D_A_10(3ISJ)
PANC_MYCTU
[Raw transfer]




AMP_A_3(3UK2)
PANC_BURTA
[Raw transfer]




A8D_B_15(3ISJ)
PANC_MYCTU
[Raw transfer]




0HN_A_3(4DDK)
PANC_MYCTU
[Raw transfer]




0HN_B_7(4DDK)
PANC_MYCTU
[Raw transfer]




AMP_A_5(3N8H)
PANC_FRATT
[Raw transfer]




I2E_B_17(4EF6)
PANC_MYCTU
[Raw transfer]




MS0_B_9(4DDH)
PANC_MYCTU
[Raw transfer]




I2E_A_6(4EF6)
PANC_MYCTU
[Raw transfer]




MS0_A_5(4DDH)
PANC_MYCTU
[Raw transfer]




0JD_A_4(4G5F)
PANC_MYCTU
[Raw transfer]




0JD_B_8(4DE5)
PANC_MYCTU
[Raw transfer]




BZ3_B_11(3IMC)
PANC_MYCTU
[Raw transfer]




15N_B_10(4G5F)
PANC_MYCTU
[Raw transfer]




0W1_B_12(4FZJ)
PANC_MYCTU
[Raw transfer]




BZ3_A_3(3IMC)
PANC_MYCTU
[Raw transfer]




0JD_A_3(4DE5)
PANC_MYCTU
[Raw transfer]




BZ2_A_3(3IMG)
PANC_MYCTU
[Raw transfer]




BZ2_A_3(3IME)
PANC_MYCTU
[Raw transfer]




PAF_G_7(1N2J)
PANC_MYCTU
[Raw transfer]




PAF_F_6(1N2J)
PANC_MYCTU
[Raw transfer]




BZ2_B_10(3IMG)
PANC_MYCTU
[Raw transfer]




BZ2_B_8(3IME)
PANC_MYCTU
[Raw transfer]




2DZ_A_7(4MUN)
PANC_MYCTO
[Raw transfer]




EDO_A_9(4FZJ)
PANC_MYCTU
[Raw transfer]




0HO_A_8(4DDM)
PANC_MYCTU
[Raw transfer]




0HO_B_9(4DDM)
PANC_MYCTU
[Raw transfer]




PAF_A_5(3Q12)
PANC_YERPE
[Raw transfer]




0OC_A_3(4EFK)
PANC_MYCTU
[Raw transfer]




144_A_8(1V8F)
PANC_THET8
[Raw transfer]




0OC_B_10(4EFK)
PANC_MYCTU
[Raw transfer]




EDO_B_5(1IHO)
PANC_ECOLI
[Raw transfer]




144_A_8(1V8F)
PANC_THET8
[Raw transfer]




BAL_E_5(1N2O)
PANC_MYCTU
[Raw transfer]




TRS_A_3(1IHO)
PANC_ECOLI
[Raw transfer]




BAL_F_6(1N2O)
PANC_MYCTU
[Raw transfer]




TRS_A_3(1IHO)
PANC_ECOLI
[Raw transfer]




71 PsiBlast_CBE 96.2799%-134 - C7 -1MOP 2.8 PANC_MYCTU
11 PsiBlast_PDB 96.2699%-131 - C7 -4DE5 3.9 PANC_MYCTU
40 PsiBlast_CBE 96.2199%-132 - C7 -4MUJ 8.4 PANC_MYCTO
83 PsiBlast_CBE 96.0299%-130 - C7 -3IMG 3.1 PANC_MYCTU
6 PsiBlast_PDB 95.8999%-132 - C7 -3IVG 2.6 PANC_MYCTU
4 PsiBlast_PDB 95.8299%-129 - C7 -3IUE 7.6 PANC_MYCTU
18 PsiBlast_PDB 95.8099%-132 - C7 -1N2I 9.7 PANC_MYCTU
67 PsiBlast_CBE 95.7699%-131 - C7 -1N2H 9.4 PANC_MYCTU
19 PsiBlast_PDB 95.7599%-128 - C7 -1N2J 2.9 PANC_MYCTU
9 PsiBlast_PDB 95.7599%-129 - C7 -4DDK 4.1 PANC_MYCTU
7 PsiBlast_PDB 95.7499%-131 - C7 -3IVX 7.7 PANC_MYCTU
2 PsiBlast_PDB 95.7399%-130 - C7 -4MQ6 7.8 PANC_MYCTO
5 PsiBlast_PDB 95.7299%-129 - C7 -3IVC 7.0 PANC_MYCTU
81 PsiBlast_CBE 95.6999%-129 - C7 -3IOB 6.2 PANC_MYCTU
12 PsiBlast_PDB 95.6799%-129 - C7 -4FZJ 2.2 PANC_MYCTU
68 PsiBlast_CBE 95.6699%-133 - C7 -1N2G 8.5 PANC_MYCTU
44 PsiBlast_CBE 95.6699%-130 - C7 -4MUH 6.7 PANC_MYCTO
87 PsiBlast_CBE 95.6199%-128 - C7 -3IMC 4.2 PANC_MYCTU
15 PsiBlast_PDB 95.5899%-129 - C7 -1N2E 9.2 PANC_MYCTU
66 PsiBlast_CBE 95.5699%-129 - C7 -1N2I 9.7 PANC_MYCTU
17 PsiBlast_PDB 95.5199%-128 - C7 -1N2H 9.6 PANC_MYCTU
36 PsiBlast_CBE 95.4899%-130 - C7 -4MUL 8.5 PANC_MYCTO
93 PsiBlast_CBE 95.4299%-129 - C7 -3COV 2.4 PANC_MYCTU
42 PsiBlast_CBE 95.4199%-136 - C7 -4MUI 7.5 PANC_MYCTO
10 PsiBlast_PDB 95.4199%-127 - C7 -4DDM 2.8 PANC_MYCTU
61 PsiBlast_CBE 95.3999%-128 - C7 -2A86 6.9 PANC_MYCTU
16 PsiBlast_PDB 95.3599%-127 - C7 -1N2G 9.5 PANC_MYCTU
88 PsiBlast_CBE 95.3099%-128 - C7 -3COZ 8.6 PANC_MYCTU
73 PsiBlast_CBE 95.2899%-128 - C7 -4G5Y 9.0 PANC_MYCTU
65 PsiBlast_CBE 95.2899%-129 - C7 -1N2J 2.7 PANC_MYCTU
8 PsiBlast_PDB 95.1999%-129 - C7 -4DDH 4.5 PANC_MYCTU
14 PsiBlast_PDB 95.0399%-128 - C7 -1N2B 8.1 PANC_MYCTU
54 PsiBlast_CBE 94.9799%-128 - C7 -4EF6 4.8 PANC_MYCTU
91 PsiBlast_CBE 94.9299%-129 - C7 -3COW 9.7 PANC_MYCTU
13 PsiBlast_PDB 94.9399%-127 - C7 -1MOP 2.9 PANC_MYCTU
74 PsiBlast_CBE 94.9299%-132 - C7 -3IOE 7.8 PANC_MYCTU
75 PsiBlast_CBE 94.9199%-130 - C7 -3IOE 7.6 PANC_MYCTU
3 PsiBlast_PDB 94.8499%-128 - C7 -3IUB 6.2 PANC_MYCTU
90 PsiBlast_CBE 94.8399%-132 - C7 -3COW 9.4 PANC_MYCTU
46 PsiBlast_CBE 94.6699%-128 - C7 -4MUG 6.8 PANC_MYCTO
58 PsiBlast_CBE 94.6199%-128 - C7 -3ISJ 4.9 PANC_MYCTU
31 PsiBlast_CBE 94.5999%-138 - C7 -3IUE 6.6 PANC_MYCTU
69 PsiBlast_CBE 94.5799%-132 - C7 -1N2E 8.8 PANC_MYCTU
70 PsiBlast_CBE 94.5499%-133 - C7 -1N2B 8.7 PANC_MYCTU
64 PsiBlast_CBE 94.4899%-133 - C7 -1N2O 3.8 PANC_MYCTU
89 PsiBlast_CBE 94.4699%-133 - C7 -3COY 8.8 PANC_MYCTU
1 PsiBlast_PDB 94.4699%-133 - C7 -4G5F 3.7 PANC_MYCTU
34 PsiBlast_CBE 94.3999%-130 - C7 -4MUN 5.3 PANC_MYCTO
57 PsiBlast_CBE 94.2999%-137 - C7 -3ISJ 5.0 PANC_MYCTU
33 PsiBlast_CBE 94.2899%-137 - C7 -4MUN 6.9 PANC_MYCTO
92 PsiBlast_CBE 94.2799%-131 - C7 -3COV 2.6 PANC_MYCTU
20 PsiBlast_PDB 94.2599%-134 - C7 -1N2O 3.3 PANC_MYCTU
28 PsiBlast_CBE 94.2499%-135 - C7 -3IVX 7.5 PANC_MYCTU
26 PsiBlast_CBE 94.2499%-131 - C7 -4DDK 4.0 PANC_MYCTU
29 PsiBlast_CBE 94.1799%-137 - C7 -3IVG 7.4 PANC_MYCTU
45 PsiBlast_CBE 94.1699%-136 - C7 -4MUG 6.2 PANC_MYCTO
39 PsiBlast_CBE 94.1099%-139 - C7 -4MUJ 7.7 PANC_MYCTO
32 PsiBlast_CBE 94.1099%-133 - C7 -3IUB 6.2 PANC_MYCTU
24 PsiBlast_CBE 94.0099%-136 - C7 -4DE5 4.1 PANC_MYCTU
85 PsiBlast_CBE 93.9399%-124 - C7 -3IME 3.1 PANC_MYCTU
23 PsiBlast_CBE 93.9099%-134 - C7 -4FZJ 4.3 PANC_MYCTU
60 PsiBlast_CBE 93.8399%-133 - C7 -2A86 6.9 PANC_MYCTU
43 PsiBlast_CBE 93.7399%-138 - C7 -4MUH 5.6 PANC_MYCTO
25 PsiBlast_CBE 93.7299%-135 - C7 -4DDM 3.0 PANC_MYCTU
48 PsiBlast_CBE 93.7199%-131 - C7 -4MUF 8.0 PANC_MYCTO
21 PsiBlast_CBE 93.6099%-140 - C7 -4MQ6 7.3 PANC_MYCTO
50 PsiBlast_CBE 93.5999%-134 - C7 -4MUE 8.1 PANC_MYCTO
77 PsiBlast_CBE 93.5899%-128 - C7 -3IOD 7.9 PANC_MYCTU
55 PsiBlast_CBE 93.5899%-136 - C7 -3LE8 8.3 PANC_MYCTU
53 PsiBlast_CBE 93.4999%-133 - C7 -4EF6 4.3 PANC_MYCTU
101 HHSearch 93.4497%-124 - C7 -3COV 2.4 PANC_MYCTU
51 PsiBlast_CBE 93.4299%-135 - C7 -4EFK 2.8 PANC_MYCTU
86 PsiBlast_CBE 93.4099%-133 - C7 -3IMC 4.2 PANC_MYCTU
37 PsiBlast_CBE 93.4099%-139 - C7 -4MUK 8.8 PANC_MYCTO
41 PsiBlast_CBE 93.3799%-136 - C7 -4MUI 6.7 PANC_MYCTO
27 PsiBlast_CBE 93.3299%-135 - C7 -4DDH 5.0 PANC_MYCTU
80 PsiBlast_CBE 93.3099%-133 - C7 -3IOB 6.2 PANC_MYCTU
38 PsiBlast_CBE 93.3099%-137 - C7 -4MUK 7.8 PANC_MYCTO
52 PsiBlast_CBE 93.2499%-130 - C7 -4EFK 3.4 PANC_MYCTU
35 PsiBlast_CBE 93.1699%-138 - C7 -4MUL 7.6 PANC_MYCTO
49 PsiBlast_CBE 93.1599%-137 - C7 -4MUE 7.6 PANC_MYCTO
82 PsiBlast_CBE 93.0499%-139 - C7 -3IMG 3.2 PANC_MYCTU
63 PsiBlast_CBE 92.9199%-133 - C7 -2A7X 7.0 PANC_MYCTU
76 PsiBlast_CBE 92.8799%-137 - C7 -3IOD 9.8 PANC_MYCTU
78 PsiBlast_CBE 92.8699%-136 - C7 -3IOC 8.5 PANC_MYCTU
62 PsiBlast_CBE 92.7799%-134 - C7 -2A84 10.0 PANC_MYCTU
72 PsiBlast_CBE 92.6599%-137 - C7 -4G5Y 9.1 PANC_MYCTU
22 PsiBlast_CBE 92.5999%-134 - C7 -4G5F 3.9 PANC_MYCTU
84 PsiBlast_CBE 92.3899%-133 - C7 -3IME 3.4 PANC_MYCTU
47 PsiBlast_CBE 92.2699%-135 - C7 -4MUF 7.7 PANC_MYCTO
79 PsiBlast_CBE 91.8799%-131 - C7 -3IOC 8.1 PANC_MYCTU
99 PsiBlast_CBE 74.7846%-127 - C7 -3INN 7.5 PANC_BRUME
100 PsiBlast_CBE 74.7746%-120 - C7 -3INN 8.4 PANC_BRUME
95 PsiBlast_CBE 73.7048%-132 - C7 -1V8F 2.7 PANC_THET8
96 PsiBlast_CBE 73.1548%-132 - C7 -1V8F 2.3 PANC_THET8
102 HHSearch 72.7943%-110 - C7 -3INN 7.5 PANC_BRUME
104 HHSearch 72.1237%-111 - C7 -3MXT 2.1 PANC_CAMJE
107 HHSearch 71.7144%-110 - C7 -3Q12 2.7 PANC_YERPE
103 HHSearch 71.4240%-108 - C7 -3AG6 9.1 PANC_STAA8
122 Fugue 71.1544%-121 - C7 -1IHO 3.0 PANC_ECOLI