@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3624c: (2016-05-21 )
MTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ

Atome Classification :

(71 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3QF_D_14(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_B_8(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_A_5(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_C_11(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_A_5(4RHX)
HPRT_MYCTU
[Raw transfer]




3QG_C_13(4RHY)
HPRT_MYCTU
[Raw transfer]




3QG_A_7(4RHY)
HPRT_MYCTU
[Raw transfer]




3QG_B_10(4RHY)
HPRT_MYCTU
[Raw transfer]




45T_C_12(4RHU)
HPRT_MYCTU
[Raw transfer]




45T_F_18(4RHU)
HPRT_MYCTU
[Raw transfer]




3QE_A_7(4RHU)
HPRT_MYCTU
[Raw transfer]




3QG_D_16(4RHY)
HPRT_MYCTU
[Raw transfer]




3QE_B_9(4RHU)
HPRT_MYCTU
[Raw transfer]




45T_D_14(4RHU)
HPRT_MYCTU
[Raw transfer]




IMP_H_8(1P17)
?
[Raw transfer]




IMP_H_8(1P19)
?
[Raw transfer]




45T_E_16(4RHU)
HPRT_MYCTU
[Raw transfer]




IMP_G_7(1P19)
?
[Raw transfer]




5GP_A_2(3ACC)
?
[Raw transfer]




5GP_E_5(1G9T)
HPRT_ECOLI
[Raw transfer]




IMP_A_2(3ACD)
?
[Raw transfer]




IMP_F_6(1P17)
?
[Raw transfer]




IMP_A_2(3ACD)
?
[Raw transfer]




5GP_B_15(3KB8)
?
[Raw transfer]




IMP_B_10(1YFZ)
?
[Raw transfer]




PRP_B_10(1I0I)
?
[Raw transfer]




PRP_B_10(1P18)
?
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




PRP_B_10(1I14)
?
[Raw transfer]




PRP_B_10(1TC2)
?
[Raw transfer]




IMP_E_5(1P17)
?
[Raw transfer]




IMP_G_7(1P17)
?
[Raw transfer]




PRP_B_9(1I0L)
?
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




IMP_E_5(1P19)
?
[Raw transfer]




PRP_B_10(1I13)
?
[Raw transfer]




IMP_F_6(1P19)
?
[Raw transfer]




5GP_B_4(1PZM)
?
[Raw transfer]




IMP_E_5(1G9S)
HPRT_ECOLI
[Raw transfer]




5GP_A_9(3KB8)
?
[Raw transfer]




GOL_C_12(3O7M)
?
[Raw transfer]




GOL_A_5(3O7M)
?
[Raw transfer]




5GP_A_3(1PZM)
?
[Raw transfer]




5GP_A_3(1PZM)
?
[Raw transfer]




PRP_A_9(1P18)
?
[Raw transfer]




PRP_A_9(1I0I)
?
[Raw transfer]




PRP_A_9(1TC2)
?
[Raw transfer]




PRP_A_9(1I14)
?
[Raw transfer]




PRP_A_9(1I13)
?
[Raw transfer]




5GP_C_14(4RHT)
HPRT_MYCTU
[Raw transfer]




FMB_D_4(1TC1)
?
[Raw transfer]




5GP_A_6(4RHT)
HPRT_MYCTU
[Raw transfer]




5GP_B_10(4RHT)
HPRT_MYCTU
[Raw transfer]




7HP_A_6(1I0L)
?
[Raw transfer]




PRP_A_8(1I0L)
?
[Raw transfer]




FMB_C_3(1TC1)
?
[Raw transfer]




7HP_A_7(1TC2)
?
[Raw transfer]




FMB_C_3(1TC1)
?
[Raw transfer]




5GP_D_18(4RHT)
HPRT_MYCTU
[Raw transfer]




SUC_B_10(3H83)
?
[Raw transfer]




MES_D_11(3HVU)
?
[Raw transfer]




MES_B_7(3HVU)
?
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




MES_C_9(3HVU)
?
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




EPE_B_12(4QYI)
?
[Raw transfer]




SUC_A_6(3H83)
?
[Raw transfer]




N_F_6(1G9S)
HPRT_ECOLI
[Raw transfer]




N_F_6(1G9T)
HPRT_ECOLI
[Raw transfer]




SUC_C_21(3KB8)
?
[Raw transfer]




PEG_A_7(4QRI)
?
[Raw transfer]




PEG_A_7(4QRI)
?
[Raw transfer]




SUC_D_25(3KB8)
?
[Raw transfer]




22 PsiBlast_CBE 94.39100%-165 - C4 -4RHY 7.2 HPRT_MYCTU
25 PsiBlast_CBE 93.59100%-160 - C4 -4RHX 8.3 HPRT_MYCTU
21 PsiBlast_CBE 93.45100%-163 - C4 -4RHY 7.4 HPRT_MYCTU
23 PsiBlast_CBE 93.32100%-164 - C4 -4RHY 7.9 HPRT_MYCTU
2 PsiBlast_PDB 93.15100%-158 - C4 -4RHU 5.5 HPRT_MYCTU
110 HHSearch 92.76100%-156 - C4 -4RHX 9.0 HPRT_MYCTU
3 PsiBlast_PDB 92.76100%-156 - C4 -4RHX 9.0 HPRT_MYCTU
31 PsiBlast_CBE 92.19100%-161 - C4 -4RHU 5.8 HPRT_MYCTU
27 PsiBlast_CBE 91.91100%-161 - C4 -4RHU 5.9 HPRT_MYCTU
30 PsiBlast_CBE 91.71100%-160 - C4 -4RHU 6.7 HPRT_MYCTU
26 PsiBlast_CBE 91.71100%-161 - C4 -4RHX 8.7 HPRT_MYCTU
4 PsiBlast_PDB 90.88100%-160 - C4 -4RHY 7.7 HPRT_MYCTU
24 PsiBlast_CBE 90.80100%-154 - C4 -4RHX 8.1 HPRT_MYCTU
34 PsiBlast_CBE 89.88100%-168 - C4 -4RHT 4.2 HPRT_MYCTU
28 PsiBlast_CBE 89.30100%-163 - C4 -4RHU 6.1 HPRT_MYCTU
1 PsiBlast_PDB 89.29100%-168 - C4 -4RHT 3.2 HPRT_MYCTU
29 PsiBlast_CBE 88.32100%-160 - C4 -4RHU 6.0 HPRT_MYCTU
32 PsiBlast_CBE 86.99100%-167 - C4 -4RHT 3.9 HPRT_MYCTU
33 PsiBlast_CBE 85.45100%-160 - C4 -4RHT 5.0 HPRT_MYCTU
128 HHSearch 83.2956%-161 - C4 -1YFZ 5.0 ?
6 PsiBlast_PDB 82.9555%-164 - C4 -1YFZ 5.0 ?
35 PsiBlast_CBE 81.2555%-160 - C4 -1YFZ 5.3 ?
9 PsiBlast_PDB 78.0648%-155 - C4 -3H83 3.1 ?
114 HHSearch 77.3249%-146 - C4 -3HVU 2.2 ?
11 PsiBlast_PDB 77.1048%-157 - C4 -3KB8 5.4 ?
42 PsiBlast_CBE 77.0648%-146 - C4 -3HVU 2.0 ?
43 PsiBlast_CBE 76.9848%-149 - C4 -3HVU 2.0 ?
10 PsiBlast_PDB 76.8448%-149 - C4 -3HVU 2.2 ?
41 PsiBlast_CBE 76.8048%-150 - C4 -3HVU 2.3 ?
72 PsiBlast_CBE 76.5943%-160 - C4 -1I14 6.5 ?
58 PsiBlast_CBE 76.4744%-156 - C4 -1TC2 6.8 ?
64 PsiBlast_CBE 76.1444%-151 - C4 -1TC1 3.9 ?
61 PsiBlast_CBE 76.0744%-158 - C4 -1P19 3.7 ?
40 PsiBlast_CBE 76.0048%-157 - C4 -3KB8 5.2 ?
78 PsiBlast_CBE 75.9343%-156 - C4 -1I13 6.9 ?
46 PsiBlast_CBE 75.5748%-150 - C4 -3H83 4.4 ?
69 PsiBlast_CBE 75.2843%-154 - C4 -1P17 4.0 ?
63 PsiBlast_CBE 75.0744%-151 - C4 -1P19 3.7 ?
76 PsiBlast_CBE 74.9943%-156 - C4 -1I0I 7.0 ?
71 PsiBlast_CBE 74.7643%-152 - C4 -1P17 4.6 ?
66 PsiBlast_CBE 74.7443%-151 - C4 -1P18 6.5 ?
59 PsiBlast_CBE 74.6544%-153 - C4 -1TC2 4.2 ?
74 PsiBlast_CBE 74.5843%-154 - C4 -1I0L 6.6 ?
79 PsiBlast_CBE 74.5243%-150 - C4 -1I13 3.2 ?
75 PsiBlast_CBE 74.5143%-153 - C4 -1I0L 3.1 ?
73 PsiBlast_CBE 74.3443%-150 - C4 -1I14 4.0 ?
38 PsiBlast_CBE 74.2948%-148 - C4 -3KB8 1.7 ?
56 PsiBlast_CBE 74.1847%-150 - C4 -3ACC 6.3 ?
77 PsiBlast_CBE 74.1143%-146 - C4 -1I0I 4.3 ?
13 PsiBlast_PDB 74.0148%-162 - C4 -1G9T 5.6 HPRT_ECOLI
39 PsiBlast_CBE 73.7948%-149 - C4 -3KB8 2.4 ?
48 PsiBlast_CBE 73.7448%-159 - C4 -1G9T 3.0 HPRT_ECOLI
19 PsiBlast_PDB 73.5841%-161 - C4 -4QYI 2.2 ?
126 HHSearch 73.4743%-146 - C4 -1TC1 3.0 ?
55 PsiBlast_CBE 73.4247%-151 - C4 -3ACD 6.0 ?
49 PsiBlast_CBE 73.4148%-157 - C4 -1G9S 3.2 HPRT_ECOLI
68 PsiBlast_CBE 73.2043%-152 - C4 -1P17 5.8 ?
53 PsiBlast_CBE 73.1941%-168 - C4 -3O7M 3.9 ?
65 PsiBlast_CBE 73.1544%-153 - C4 -1TC1 3.0 ?
20 PsiBlast_PDB 73.1441%-170 - C4 -3O7M 2.1 ?
67 PsiBlast_CBE 73.1143%-150 - C4 -1P18 3.4 ?
12 PsiBlast_PDB 72.5348%-159 - C4 -1G9S 5.0 HPRT_ECOLI
60 PsiBlast_CBE 72.2644%-156 - C4 -1P19 4.8 ?
70 PsiBlast_CBE 72.1743%-151 - C4 -1P17 5.6 ?
118 HHSearch 72.0946%-150 - C4 -3ACD 6.0 ?
82 PsiBlast_CBE 70.6139%-159 - C4 -1PZM 7.0 ?
83 PsiBlast_CBE 70.5139%-153 - C4 -1PZM 5.7 ?
62 PsiBlast_CBE 70.2344%-151 - C4 -1P19 5.5 ?
115 HHSearch 69.4941%-160 - C4 -4QRI 2.6 ?
81 PsiBlast_CBE 69.2742%-161 - C4 -4QRI 2.6 ?
117 HHSearch 69.2237%-148 - C4 -1PZM 5.7 ?