@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3742c: (2016-05-22 )
MHSEQSASIEHVDVLIVGAGISGTGAAYYLKTMQPAKTFAIVEARYPAIRSDSDLHTFSYEFKPWQHEKATASADAIMVHRGRSLAGGDRTLRHRRTRHHELRMVIIGSGATAVTLVPAMAQTAGAVTMPK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEG_A_6(2V3A)
RURE_PSEAE
[Raw transfer]




FAD_A_4(4AP3)
?
[Raw transfer]




FAD_A_2(1W4X)
PAMO_THEFY
[Raw transfer]




11 PsiBlast_PDB 73.7830% -98 - C5 -4C77 - PAMO_THEFY -
4 PsiBlast_PDB 73.5830% -94 - C5 -2YLS - PAMO_THEFY -
3 PsiBlast_PDB 73.2630% -93 - C5 -2YLR - PAMO_THEFY -
12 PsiBlast_PDB 73.2130% -90 - C5 -4D03 - PAMO_THEFY -
9 PsiBlast_PDB 72.9430% -86 - C5 -2YM1 - PAMO_THEFY -
13 PsiBlast_PDB 72.8130% -82 - C5 -4D04 - PAMO_THEFY -
6 PsiBlast_PDB 72.7230% -85 - C5 -4C74 - PAMO_THEFY -
5 PsiBlast_PDB 72.4630% -90 - C5 -2YLT - PAMO_THEFY -
8 PsiBlast_PDB 72.2830% -87 - C5 -2YLW - PAMO_THEFY -
7 PsiBlast_PDB 72.0330% -89 - C5 -4OVI - PAMO_THEFY -
2 PsiBlast_PDB 71.8930% -91 - C5 -1W4X - PAMO_THEFY -
131 HHSearch 71.8722% -91 - C5 -4RG3 - ? -
126 Fugue 71.7030% -68 - C5 -4UIR - OLHYD_ELIME -
1 PsiBlast_PDB 71.5130% -84 - C5 -2YLZ - PAMO_THEFY -
10 PsiBlast_PDB 70.7030% -86 - C5 -2YM2 - PAMO_THEFY -
15 PsiBlast_PDB 70.2032% -92 - C5 -2YLX - PAMO_THEFY -
16 PsiBlast_PDB 63.2128% -64 - C5 -4AP3 - ? -
19 PsiBlast_PDB 62.2328% -65 - C5 -4AOX - ? -
18 PsiBlast_PDB 61.6228% -63 - C5 -4AOS - ? -
17 PsiBlast_PDB 61.2528% -59 - C5 -4AP1 - ? -
132 HHSearch 55.0639%-101 - C5 -1W4X 4.2 PAMO_THEFY
134 HHSearch 45.7232% -68 * C5 *4AP3 4.1 ?