@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3855: (2016-05-23 )
MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LL3_A_2(3Q0U)
ETHR_MYCTU
[Raw transfer]




O8H_A_2(3O8H)
ETHR_MYCTU
[Raw transfer]




5T0_A_2(5EYR)
?
[Raw transfer]




5TC_A_2(5F0H)
?
[Raw transfer]




5T0_A_2(5EYR)
?
[Raw transfer]




2D1_A_2(4M3F)
ETHR_MYCTO
[Raw transfer]




5TB_A_2(5F04)
?
[Raw transfer]




5TG_A_2(5F08)
?
[Raw transfer]




5TD_A_2(5F0F)
?
[Raw transfer]




LL4_A_3(3Q0V)
ETHR_MYCTU
[Raw transfer]




0MN_A_2(4DW6)
ETHR_MYCTU
[Raw transfer]




LL4_B_4(3Q0V)
ETHR_MYCTU
[Raw transfer]




RF3_A_2(3G1M)
ETHR_MYCTU
[Raw transfer]




5TE_A_2(5F0C)
?
[Raw transfer]




3SF_A_2(3SFI)
ETHR_MYCTU
[Raw transfer]




O8G_A_2(3O8G)
ETHR_MYCTU
[Raw transfer]




RF2_A_2(3G1L)
ETHR_MYCTU
[Raw transfer]




841_A_3(5EZH)
?
[Raw transfer]




2H2_A_2(4M3D)
ETHR_MYCTU
[Raw transfer]




CNS_C_3(1U9O)
ETHR_MYCTU
[Raw transfer]




RF2_A_2(3G1L)
ETHR_MYCTU
[Raw transfer]




2B3_A_2(4M3E)
ETHR_MYCTU
[Raw transfer]




RF1_A_2(3G1O)
ETHR_MYCTU
[Raw transfer]




2G1_A_2(4M3G)
ETHR_MYCTU
[Raw transfer]




2B2_A_2(4M3B)
ETHR_MYCTU
[Raw transfer]




CNS_D_4(1U9O)
ETHR_MYCTU
[Raw transfer]




O8B_A_2(3Q3S)
ETHR_MYCTU
[Raw transfer]




FO5_A_2(3TP0)
ETHR_MYCTU
[Raw transfer]




3SE_A_2(3SDG)
ETHR_MYCTU
[Raw transfer]




5TT_A_3(5F27)
?
[Raw transfer]




LL5_A_2(3Q0W)
ETHR_MYCTU
[Raw transfer]




DIO_E_5(1T56)
ETHR_MYCTU
[Raw transfer]




DIO_E_5(1T56)
ETHR_MYCTU
[Raw transfer]




5T4_A_3(5EZG)
?
[Raw transfer]




5TO_A_3(5F1J)
?
[Raw transfer]




26 PsiBlast_CBE 94.4099%-126 - C2 -5F0F 8.5 ?
98 HHSearch 94.12100%-127 - C2 -3G1L 8.7 ETHR_MYCTU
1 PsiBlast_PDB 93.94100%-127 * C2 *3G1L 8.7 ETHR_MYCTU
7 PsiBlast_PDB 93.83100%-127 - C2 -3SFI 9.3 ETHR_MYCTU
99 HHSearch 93.62100%-125 - C2 -5EYR 9.6 ?
89 Fugue 93.47100%-125 - C2 -1T56 2.0 ETHR_MYCTU
13 PsiBlast_PDB 93.30100%-125 - C2 -1T56 2.0 ETHR_MYCTU
4 PsiBlast_PDB 93.30100%-130 - C2 -3O8G 7.3 ETHR_MYCTU
28 PsiBlast_CBE 93.2499%-121 - C2 -5F08 8.8 ?
32 PsiBlast_CBE 93.2399%-125 - C2 -5EYR 9.6 ?
31 PsiBlast_CBE 93.1599%-125 - C2 -5EZG 8.1 ?
30 PsiBlast_CBE 93.0099%-123 - C2 -5EZH 8.2 ?
2 PsiBlast_PDB 93.00100%-125 - C2 -3G1O 8.3 ETHR_MYCTU
18 PsiBlast_PDB 92.84100%-125 - C2 -4M3F 7.8 ETHR_MYCTO
27 PsiBlast_CBE 92.5399%-126 - C2 -5F0C 9.6 ?
25 PsiBlast_CBE 92.4999%-124 - C2 -5F0H 10.6 ?
19 PsiBlast_PDB 92.35100%-124 - C2 -4M3G 8.3 ETHR_MYCTU
21 PsiBlast_CBE 92.27100%-129 - C2 -3Q0V 8.4 ETHR_MYCTU
9 PsiBlast_PDB 92.27100%-126 - C2 -3Q0U 10.1 ETHR_MYCTU
8 PsiBlast_PDB 92.24100%-121 - C2 -3Q0W 7.2 ETHR_MYCTU
24 PsiBlast_CBE 92.1899%-125 - C2 -5F1J 6.1 ?
17 PsiBlast_PDB 91.82100%-124 - C2 -4M3E 9.2 ETHR_MYCTU
29 PsiBlast_CBE 91.8199%-127 - C2 -5F04 8.8 ?
5 PsiBlast_PDB 91.55100%-127 - C2 -3O8H 10.9 ETHR_MYCTU
3 PsiBlast_PDB 91.28100%-125 - C2 -3G1M 9.5 ETHR_MYCTU
11 PsiBlast_PDB 91.22100%-122 - C2 -3Q3S 11.0 ETHR_MYCTU
14 PsiBlast_PDB 91.17100%-130 - C2 -3TP0 7.4 ETHR_MYCTU
10 PsiBlast_PDB 90.59100%-130 - C2 -3Q0V 8.7 ETHR_MYCTU
16 PsiBlast_PDB 90.43100%-122 - C2 -4M3D 10.2 ETHR_MYCTU
15 PsiBlast_PDB 89.98100%-129 - C2 -4M3B 8.8 ETHR_MYCTU
23 PsiBlast_CBE 89.8399%-131 - C2 -5F27 5.7 ?
12 PsiBlast_PDB 89.44100%-126 - C2 -4DW6 10.5 ETHR_MYCTU
20 PsiBlast_PDB 89.2299%-126 - C2 -1U9O 7.6 ETHR_MYCTU
6 PsiBlast_PDB 89.09100%-130 - C2 -3SDG 9.0 ETHR_MYCTU
22 PsiBlast_CBE 88.7999%-120 - C2 -1U9O 7.1 ETHR_MYCTU