@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0009: (2015-12-18 )
MSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSLKAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYLQGVDSVYDLVWTDGPFGKVTYGDVFHQNEVEQSTFNFEHANVPKLFELFDFYESEANRLIALELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARAVAQSYLQARARLGFPMATPELRDEVLAKLKEAE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_4(3RGL)
SYGA_CAMJE
[Raw transfer]




ATP_A_4(3UFG)
SYGA_CAMJE
[Raw transfer]




LMR_A_3(3RF1)
SYGA_CAMJJ
[Raw transfer]




LMR_A_3(3RF1)
SYGA_CAMJJ
[Raw transfer]




7 HHSearch 97.3460% -98 - C6 -3RF1 3.1 SYGA_CAMJJ
2 PsiBlast_PDB 95.9161%-102 - C6 -3RGL 4.5 SYGA_CAMJE
1 PsiBlast_PDB 95.7761%-100 - C6 -3RF1 3.1 SYGA_CAMJJ
3 PsiBlast_PDB 95.5461%-100 - C6 -3UFG 7.0 SYGA_CAMJE
10 HHSearch 56.4421% -91 - C6 -2ZTG - SYA_ARCFU -
15 HHSearch 55.0418%-110 - C6 -3DSQ - ? -
9 HHSearch 53.9621% -87 - C6 -3WQY - SYA_ARCFU -
12 HHSearch 52.8917% -93 - C6 -1YFS - SYA_AQUAE -
13 HHSearch 51.9718% -88 - C6 -3HY0 - SYA_ECOLI -
22 HHSearch 50.6817% -98 - C6 -3PCO - ? -
21 HHSearch 46.6715% -90 - C6 -1B7Y - SYFA_THETH -
19 HHSearch 44.7719% -98 - C6 -2DU3 - SEPS_ARCFU -
24 HHSearch 42.0716% -77 * C6 *3L4G - SYFA_HUMAN -
17 HHSearch 41.2616% -65 - C6 -2DQ0 - SYS_PYRHO -
26 HHSearch 39.2216% -75 - C6 -3W3S - SYS2_METKA -
14 HHSearch 36.7716% -72 - C6 -1SES - SYS_THET2 -
16 HHSearch 34.8516% -66 - C6 -3ERR - DYHC1_MOUSE (first) -
30 Fugue 33.9815% -40 - C4 -4CR2 - PSA5_YEAST (first) -
33 Fugue 31.0923% -42 - C2 -4P42 - ESYT2_HUMAN -
4 PsiBlast_PDB 29.8430% -86 - C6 -2ZZF - SYA_PYRHO -