@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0010: (2015-12-18 )
MPRCFWCNDDPLYMAYHDEEWGVPQRDPDALFELLLLEGFQAGLSWITVLKKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRAKLNAARQNAQAWLELDDPAGFLWSFVGGQPKINHFAGRAEVPAITPEAEAMSKALRKAGFNFVGPTICYAFMQASGMVMDHTQDCDRYAQLVG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGE_A_5(2OFK)
?
[Raw transfer]




PGE_A_5(2OFK)
?
[Raw transfer]




PGE_B_6(2OFK)
?
[Raw transfer]




ADK_A_6(2OFI)
?
[Raw transfer]




NACID_B_2(2OFI)
?
[Raw transfer]

-

NACID_C_1(2OFI)
?
[Raw transfer]

-

27 HHSearch 99.2153%-112 - C4 -2OFK 2.8 ?
17 PsiBlast_CBE 97.7553%-115 - C4 -2OFK 2.6 ?
1 PsiBlast_PDB 97.2853%-113 - C4 -2OFK 2.8 ?
3 PsiBlast_PDB 97.0151%-112 - C4 -2OFI 4.6 ?
2 PsiBlast_PDB 92.8052%-102 - C4 -1LMZ - 3MG1_ECOLI -
48 Fugue 92.1951% -98 - C4 -1LMZ - 3MG1_ECOLI -
26 HHSearch 91.1740%-101 - C4 -2JG6 - ? -
25 PsiBlast_CBE 90.7440%-109 - C4 -4AI5 - ? -
20 PsiBlast_CBE 90.7440%-105 - C4 -4AIA - ? -
6 PsiBlast_PDB 90.7040%-107 - C4 -4AI4 - ? -
5 PsiBlast_PDB 90.0740%-105 - C4 -4AIA - ? -
22 PsiBlast_CBE 90.0040%-107 - C4 -4AI5 - ? -
24 PsiBlast_CBE 89.9240%-106 - C4 -4AI5 - ? -
21 PsiBlast_CBE 89.8040%-108 - C4 -4AIA - ? -
19 PsiBlast_CBE 89.4640%-110 - C4 -4AIA - ? -
4 PsiBlast_PDB 89.2640%-105 - C4 -2JG6 - ? -
18 PsiBlast_CBE 89.0840%-106 - C4 -4AIA - ? -
23 PsiBlast_CBE 88.8340%-108 - C4 -4AI5 - ? -
7 PsiBlast_PDB 88.7140%-104 - C4 -4AI5 - ? -
33 HHSearch 47.4310% -89 - C4 -3S6I - MAG1_SCHPO -