@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0022: (2015-12-18 )
MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLALKARPVEKGLIVVAANIHQLDFLLEDLPDVWLDRLAGTWPGPNTWLVPHQERLPEWVTGVHDSVAVRVTDHPLVQELCHLTGPLISTSANPAGRPAARTRLRVEQYFHDELDAILGGALGGRRNPSLIRDLVTGQVIRPA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_A_3(2EQA)
SUA5_SULTO
[Raw transfer]




22 HHSearch 94.6151%-119 - C3 -1HRU - TSAC_ECOLI -
32 Fugue 93.2450%-120 - C3 -1HRU - TSAC_ECOLI -
1 PsiBlast_PDB 93.0051%-127 - C3 -1HRU - TSAC_ECOLI -
33 Fugue 91.5948%-121 - C3 -1HRU - TSAC_ECOLI -
21 HHSearch 83.6935%-114 * C3 *2EQA 4.3 SUA5_SULTO
3 PsiBlast_PDB 82.1237%-130 - C3 -2EQA - SUA5_SULTO -
4 PsiBlast_PDB 81.7437%-130 - C3 -4E1B - SUA5_SULTO -
2 PsiBlast_PDB 81.6737%-132 - C3 -3AJE - SUA5_SULTO -
7 PsiBlast_PDB 74.6623%-110 - C3 -1KK9 - YCIO_ECOLI -
23 HHSearch 73.3223%-100 - C3 -1K7J - YCIO_ECOLI -
6 PsiBlast_PDB 73.1723%-105 - C3 -1K7J - YCIO_ECOLI -
20 PsiBlast_PDB 67.8226%-107 - C3 -3TSQ - ? -
25 HHSearch 66.0820%-101 - C3 -3VTH - ? -
36 Fugue 65.7826% -92 - C3 -3TTC - ? -
5 PsiBlast_PDB 64.9430%-105 - C3 -1JCU - ? -
26 HHSearch 63.0623% -88 - C3 -3TTC - ? -
24 HHSearch 56.2617% -89 - C3 -3L7V - ? -
27 HHSearch 45.6915% -96 - C3 -3VEN - TOBZ_STRSD -
39 Fugue 45.6215% -70 - C3 -1AF7 - ? -
37 Fugue 34.2013% -52 - C3 -2X9Q - CDTS_MYCTU -