@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0023: (2015-12-18 )
MAKRIQFAAYGGPEVLEYRDYQPAEPGPREVRVRNRAIGLNFIDTYYRSGLYPAPGLPSGLGSEGAGEVEAVGSEVTRFKVGDRVAYATGPLGAYSELHVLAEEKLVHLPDGIDFEQAAAVMLKGLTTQYLLRQTYELRGGETILFHAAAGGVGLFACQWAKALGVQLIGTVSSPEKARLARQHGAWETIDYSHENVARRVLELTDGKKCPVVYDSVGKDTWETSLDCVAPRGLLVSFGNASGPVTGVNLGILSQKGSLYVTRPTLGSYADTPEKLQAMADELFGLIERGDIRIEINQRFALAEAARAHTELAARRTTGSTVLLP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_A_2(3JYN)
?
[Raw transfer]




NDP_A_2(3JYN)
?
[Raw transfer]




NAP_A_5(1QOR)
QOR1_ECOLI
[Raw transfer]




NAP_A_5(1QOR)
QOR1_ECOLI
[Raw transfer]




NAP_B_6(1QOR)
QOR1_ECOLI
[Raw transfer]




NDP_A_5(4RVU)
?
[Raw transfer]




NDP_C_7(4RVU)
?
[Raw transfer]




NDP_B_6(4RVU)
?
[Raw transfer]




NDP_D_8(4RVU)
?
[Raw transfer]




1 PsiBlast_PDB 96.9974%-101 * C1 *3JYL - ? -
92 HHSearch 96.7475%-100 - C1 -3JYN 11.5 ?
2 PsiBlast_PDB 96.4274%-100 - C1 -3JYN 11.5 ?
98 HHSearch 89.8159% -99 - C1 -1QOR 11.4 QOR1_ECOLI
21 PsiBlast_CBE 89.7158% -97 - C1 -1QOR 12.1 QOR1_ECOLI
3 PsiBlast_PDB 89.4758%-100 - C1 -1QOR 11.4 QOR1_ECOLI
6 PsiBlast_PDB 84.3945%-103 - C1 -4RVS - ? -
5 PsiBlast_PDB 84.0345% -95 - C1 -4RVU 12.0 ?
23 PsiBlast_CBE 82.9445% -96 - C1 -4RVU 12.0 ?
24 PsiBlast_CBE 82.3345% -95 - C1 -4RVU 11.0 ?
22 PsiBlast_CBE 82.3145% -95 - C1 -4RVU 11.5 ?
99 HHSearch 77.1042% -91 - C1 -1WLY - CAA43_BURSP -
4 PsiBlast_PDB 77.0344% -98 - C1 -1WLY - CAA43_BURSP -
25 PsiBlast_CBE 75.0336% -88 - C1 -3QWB - QOR_YEAST -
27 PsiBlast_CBE 74.6336% -86 - C1 -3QWB - QOR_YEAST -
26 PsiBlast_CBE 74.2036% -87 - C1 -3QWB - QOR_YEAST -
97 HHSearch 73.8835% -90 - C1 -3QWB - QOR_YEAST -
7 PsiBlast_PDB 73.6336% -89 - C1 -3QWA - QOR_YEAST -
8 PsiBlast_PDB 73.2036% -86 - C1 -3QWB - QOR_YEAST -
95 HHSearch 69.2234% -86 - C1 -2EIH - ? -