@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0035: (2015-12-19 )
MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGADVIELGMPFTDPMADGPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGYFNPIHHYGVERFIAEAKEVGVDGLIVVDLPPEHNEDLCHPAQAAGIDFIRLTTPTTGDQRLPTVLEGSSGFVYYVSVAGVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAAVARLADGVVVGSALIDRIAKARDNAQAVKDVLALCGELAEGVRNAR

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HPF_A_4(1TJP)
TRPA_SALTY
[Raw transfer]




HE1_A_4(1C8V)
TRPA_SALTY
[Raw transfer]




IPL_A_4(2TRS)
TRPA_SALTY
[Raw transfer]




HE1_A_5(1C29)
TRPA_SALTY
[Raw transfer]




FIP_A_4(1FUY)
TRPA_SALTY
[Raw transfer]




IPL_A_6(1WXJ)
TRPA_THET2
[Raw transfer]




IAG_A_4(1K8Z)
TRPA_SALTY
[Raw transfer]




G3P_A_6(3CEP)
TRPA_SALTY
[Raw transfer]




CIT_A_2(1UJP)
TRPA_THET2
[Raw transfer]




EDO_A_3(3NAV)
TRPA_VIBCH
[Raw transfer]




2 PsiBlast_PDB 95.1539%-113 - C1 -1RD5 - TRPA_MAIZE -
103 HHSearch 94.2038%-120 - C1 -2EKC - TRPA_AQUAE -
108 HHSearch 94.0838%-118 - C1 -1RD5 - TRPA_MAIZE -
21 PsiBlast_CBE 93.8539%-111 - C1 -1RD5 - TRPA_MAIZE -
4 PsiBlast_PDB 93.7643%-123 - C1 -2DZW - TRPA_PYRFU -
93 Fugue 93.7440%-124 - C1 -1GEQ - TRPA_PYRFU -
1 PsiBlast_PDB 93.6137%-124 - C1 -2EKC - TRPA_AQUAE -
11 PsiBlast_PDB 93.0939%-105 - C1 -1TJR - TRPA_MAIZE -
5 PsiBlast_PDB 92.2243%-125 - C1 -1GEQ - TRPA_PYRFU -
7 PsiBlast_PDB 92.1441%-125 - C1 -1UJP 3.2 TRPA_THET2
8 PsiBlast_PDB 91.3541%-122 - C1 -1WXJ 5.2 TRPA_THET2
9 PsiBlast_PDB 90.5842%-121 - C1 -2DZP - TRPA_PYRFU -
10 PsiBlast_PDB 90.5142%-122 - C1 -2DZU - TRPA_PYRFU -
6 PsiBlast_PDB 90.1743%-121 - C1 -1WDW - TRPA_PYRFU -
14 PsiBlast_PDB 90.1342%-126 - C1 -2DZT - TRPA_PYRFU -
13 PsiBlast_PDB 90.1342%-118 - C1 -2E09 - TRPA_PYRFU -
3 PsiBlast_PDB 90.1143%-119 - C1 -2DZX - TRPA_PYRFU -
105 HHSearch 90.0641%-127 * C1 *1UJP - TRPA_THET2 -
15 PsiBlast_PDB 89.9342%-121 - C1 -2DZV - TRPA_PYRFU -
12 PsiBlast_PDB 89.7842%-121 - C1 -2DZS - TRPA_PYRFU -
32 PsiBlast_CBE 86.4537%-106 - C1 -3CEP 4.3 TRPA_SALTY
65 PsiBlast_CBE 85.9837%-103 - C1 -1C29 4.2 TRPA_SALTY
64 PsiBlast_CBE 85.4937%-101 - C1 -1C8V 4.0 TRPA_SALTY
53 PsiBlast_CBE 85.4537%-105 - C1 -1TJP 4.4 TRPA_SALTY
55 PsiBlast_CBE 85.0037%-105 - C1 -1K8Z 4.6 TRPA_SALTY
106 HHSearch 84.9134%-108 - C1 -3NAV 2.7 TRPA_VIBCH
60 PsiBlast_CBE 84.9137%-102 - C1 -1FUY 6.1 TRPA_SALTY
42 PsiBlast_CBE 84.7337%-100 - C1 -2TRS 5.1 TRPA_SALTY