@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0038: (2015-12-19 )
MSNHHTYKKIELVGSSKTSIEDAINNALAEAAKSIQHLEWFEVVDTRGHIENGAVGHYQVTLKVGFRIANS

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_8(2YIZ)
?
[Raw transfer]




GOL_A_8(2YIZ)
?
[Raw transfer]




COA_E_22(2UX9)
DODEC_THET8
[Raw transfer]




COA_E_23(2YJ0)
?
[Raw transfer]




GOL_A_7(2YIZ)
?
[Raw transfer]




37 PsiBlast_CBE 96.5453%-109 - C15 -3OQT - ? -
36 PsiBlast_CBE 95.9553%-108 - C15 -3OQT - ? -
2 PsiBlast_PDB 95.1553%-109 - C15 -3OQT - ? -
32 PsiBlast_CBE 95.0353%-118 - C15 -3OQT - ? -
38 PsiBlast_CBE 94.5153%-109 - C15 -3OQT - ? -
27 PsiBlast_CBE 94.5062%-115 - C15 -2VXA - DODEC_HALHL -
21 PsiBlast_CBE 93.9162%-108 - C15 -2VXA - DODEC_HALHL -
35 PsiBlast_CBE 93.8353%-106 - C15 -3OQT - ? -
25 PsiBlast_CBE 93.6062%-110 - C15 -2VXA - DODEC_HALHL -
31 PsiBlast_CBE 93.5462%-109 - C15 -2VXA - DODEC_HALHL -
1 PsiBlast_PDB 93.4262%-110 - C15 -2VXA - DODEC_HALHL -
39 PsiBlast_CBE 93.0953%-105 - C15 -3OQT - ? -
29 PsiBlast_CBE 92.9362%-110 - C15 -2VXA - DODEC_HALHL -
26 PsiBlast_CBE 92.6562%-110 - C15 -2VXA - DODEC_HALHL -
24 PsiBlast_CBE 92.5962%-110 - C15 -2VXA - DODEC_HALHL -
30 PsiBlast_CBE 92.5462%-110 - C15 -2VXA - DODEC_HALHL -
34 PsiBlast_CBE 92.3753%-109 - C15 -3OQT - ? -
42 PsiBlast_CBE 91.3350%-106 - C15 -2YIZ - ? -
22 PsiBlast_CBE 91.2962%-113 - C15 -2VXA - DODEC_HALHL -
40 PsiBlast_CBE 91.0050%-104 - C15 -2YIZ - ? -
47 PsiBlast_CBE 89.8149%-107 - C15 -2YJ0 1.6 ?
106 HHSearch 89.7351%-106 - C15 -2YIZ Error ?
3 PsiBlast_PDB 89.3950%-106 - C15 -2YIZ 2.9 ?
105 HHSearch 87.3748%-106 - C15 -2UX9 3.6 DODEC_THET8