@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0132: (2015-12-23 )
MNQPLNVAPPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIAGLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDASNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGLQGAKNVIDIRNCGLAGAIQIAPRDGDPTVRPFEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALNGIA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PLP_X_2(3A8U)
OAPT_PSEPU
[Raw transfer]
25 PsiBlast_CBE 97.97100%-104 - C1 -4B9B - BAUA_PSEAE -
1 PsiBlast_PDB 97.94100%-104 * C1 *4B98 - BAUA_PSEAE -
28 PsiBlast_CBE 97.70100%-106 - C1 -4B9B - BAUA_PSEAE -
26 PsiBlast_CBE 97.65100%-106 - C1 -4B9B - BAUA_PSEAE -
29 PsiBlast_CBE 97.49100%-105 - C1 -4B9B - BAUA_PSEAE -
27 PsiBlast_CBE 97.29100%-106 - C1 -4B9B - BAUA_PSEAE -
30 PsiBlast_CBE 97.26100%-105 - C1 -4B9B - BAUA_PSEAE -
23 PsiBlast_CBE 97.20100%-105 - C1 -4BQ0 - BAUA_PSEAE -
2 PsiBlast_PDB 96.84100%-106 - C1 -4B9B - BAUA_PSEAE -
24 PsiBlast_CBE 96.61100%-104 - C1 -4B9B - BAUA_PSEAE -
32 PsiBlast_CBE 96.59100%-103 - C1 -4B98 - BAUA_PSEAE -
33 PsiBlast_CBE 96.36100%-105 - C1 -4B98 - BAUA_PSEAE -
22 PsiBlast_CBE 95.94100%-102 - C1 -4BQ0 - BAUA_PSEAE -
31 PsiBlast_CBE 95.56100%-103 - C1 -4B98 - BAUA_PSEAE -
3 PsiBlast_PDB 95.53100%-103 - C1 -4BQ0 - BAUA_PSEAE -
21 PsiBlast_CBE 94.69100%-103 - C1 -4BQ0 - BAUA_PSEAE -
4 PsiBlast_PDB 87.3777% -99 - C1 -3A8U - OAPT_PSEPU -
74 HHSearch 86.2178% -99 - C1 -3A8U 4.2 OAPT_PSEPU
71 HHSearch 63.4530%-100 - C1 -3DOD - BIOK_BACSU -
5 PsiBlast_PDB 62.4235% -87 - C1 -3HMU - ? -