@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0162: (2015-12-24 )
MRNLFALTPMALALCTASAAWADEGEAKEGFIEGSSLQLLTRNYYFNHDRRHASGHDSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLDGGGGTGGTSILPITSPSKEGYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLSNPVVAGGESRMLPQTFRGVSLTNNSFEDLTLTAGQVSFTKYYNQSGHRRLGSYYGELPGDRDSHHLSWLGGTWGGIEGFTSSLYAAELQNVWKQYYADVDYTYEIDDNWSLNPGAHYYKTVDSGDSLLGRIDNNTYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNEKSWKLQYDYDFVALGLPGLSASASYSRGKLDLTRVDPDSPGYGGWYSADGKNAKHWERDLDLQYVVQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPIDVF

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

C8E_A_5(2Y0H)
?
[Raw transfer]




C8E_A_5(2Y0H)
?
[Raw transfer]




C8E_A_5(3T0S)
?
[Raw transfer]




C8E_A_9(3SY7)
PORD_PSEAE
[Raw transfer]




C8E_A_16(4FMS)
?
[Raw transfer]




C8E_B_8(4FMS)
?
[Raw transfer]




22 PsiBlast_CBE 96.6799% -45 - C7 -3SY9 - ? -
1 PsiBlast_PDB 95.6199% -40 - C7 -3SY9 - ? -
21 PsiBlast_CBE 95.0899% -48 - C7 -3SY9 - ? -
23 PsiBlast_CBE 94.3199% -40 - C7 -3SY9 - ? -
66 HHSearch 92.1996% -37 - C7 -3SY9 - ? -
2 PsiBlast_PDB 71.8743% -19 - C7 -3SY7 - PORD_PSEAE -
67 HHSearch 71.3035% -27 * C7 *2Y2X - ? -
3 PsiBlast_PDB 70.6842% -23 - C7 -2ODJ - PORD_PSEAE -
8 PsiBlast_PDB 69.9133% -28 - C7 -2Y2X - ? -
68 HHSearch 69.5842% -15 - C7 -3SY7 2.5 PORD_PSEAE
9 PsiBlast_PDB 69.5133% -28 - C7 -3SYS - ? -
27 PsiBlast_CBE 69.3333% -25 - C7 -2Y2X - ? -
26 PsiBlast_CBE 69.2633% -26 - C7 -3SYS - ? -
19 PsiBlast_PDB 69.2030% -26 - C7 -4FRX - ? -
5 PsiBlast_PDB 68.8136% -25 - C7 -3T20 - ? -
10 PsiBlast_PDB 68.7636% -23 - C7 -4FT6 - ? -
15 PsiBlast_PDB 68.7032% -30 - C7 -3T0S 3.4 ?
14 PsiBlast_PDB 68.7032% -30 - C7 -2Y0H 3.4 ?
4 PsiBlast_PDB 68.5336% -26 - C7 -2Y0L - ? -
72 HHSearch 68.2736% -20 - C7 -2Y0L - ? -
71 HHSearch 67.8733% -26 - C7 -2Y0H 3.4 ?
30 PsiBlast_CBE 66.4633% -22 - C7 -4FMS 1.6 ?
17 PsiBlast_PDB 63.5733% -21 - C7 -4FMS 3.1 ?