@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0254: (2015-12-28 )
MNRSALDFRHFVDHLRRQGDLVDVHTEVDANLEIGAITRRVYERRAPAPLFHNIRDSLPGARVLGAPAGLRADRARAHSRLALHFGLPEHSGPRDIVAMLRAAMRAEPIAPRRLERGPVQENVWLGEQVDLTRFPVPLLHEQDGGRYFGTYGFHVVQTPDGSWDSWSVGRLMLVDRNTLAGPTIPTQHIGIIREQWRRLGKPTPWAMALGAPPAALAAAGMPLPEGVSEAGYVGALVGEPVEVVRTQTNGLWVPANTEIVLEGEISLDETALEGPMGEYHGYSFPIGKPQPLFHVHALSFRDQPILPICVAGTPPEENHTIWGTMISAQLLDVAQNAGLPVDMVWCSYEAATCWAVLSIDVQRLAALGTDAAAFAARVAETVFGSHAGHLVPKLILVGNDIDVTEIDQVVWALATRAHPLHDHFAFPQIRDFPMVPYLDAEDKARGSGGRLVINCLYPEQFAGQMRAATASFRHAYPTALRRRVEERWSDYGFGDA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

4MJ_A_2(4ZA9)
?
[Raw transfer]




4LU_A_2(4ZAA)
?
[Raw transfer]




2 PsiBlast_PDB 99.63100%-116 - C8 -4IP2 - ? -
41 Fugue 99.13100%-113 - C8 -4IWS - ? -
1 PsiBlast_PDB 99.13100%-113 - C8 -4IWS - ? -
17 PsiBlast_CBE 99.12100%-115 - C8 -4IP2 - ? -
16 PsiBlast_CBE 98.94100%-116 - C8 -4IP2 - ? -
15 PsiBlast_CBE 98.92100%-115 - C8 -4IWS - ? -
4 PsiBlast_PDB 84.5740%-106 - C8 -4ZAA 6.5 ?
3 PsiBlast_PDB 84.4740%-105 - C8 -4ZA9 11.8 ?
25 PsiBlast_CBE 83.5537%-106 - C8 -4ZAD - ? -
18 PsiBlast_CBE 83.2139%-107 - C8 -4ZAC - FDC1_YEAST -
6 PsiBlast_PDB 83.0637%-104 - C8 -4ZAD - ? -
20 PsiBlast_CBE 82.8939%-106 - C8 -4ZAC - FDC1_YEAST -
19 PsiBlast_CBE 82.8439%-107 - C8 -4ZAC - FDC1_YEAST -
5 PsiBlast_PDB 82.7939%-108 - C8 -4ZAC - FDC1_YEAST -
21 PsiBlast_CBE 82.5139%-111 - C8 -4S13 - FDC1_YEAST -
24 PsiBlast_CBE 82.2739%-109 - C8 -4S13 - FDC1_YEAST -
22 PsiBlast_CBE 82.1039%-108 - C8 -4S13 - FDC1_YEAST -
23 PsiBlast_CBE 81.9439%-108 - C8 -4S13 - FDC1_YEAST -
31 HHSearch 69.5726% -96 * C8 *2IDB - UBID_ECOLI -
46 Fugue 48.4318% -43 - C9 -1DFO - GLYA_ECOLI -