@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0301: (2015-12-30 )
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PUT_B_4(3TTM)
SPUD_PSEAE
[Raw transfer]




PUT_A_3(3TTM)
SPUD_PSEAE
[Raw transfer]




SPD_A_3(3TTN)
SPUE_PSEAE
[Raw transfer]




1 PsiBlast_PDB 98.77100%-109 - C2 -3TTL - SPUE_PSEAE -
30 HHSearch 95.4299% -96 - C2 -3TTN 4.3 SPUE_PSEAE
2 PsiBlast_PDB 95.2198% -96 - C2 -3TTN - SPUE_PSEAE -
4 PsiBlast_PDB 85.9258% -99 - C2 -3TTK - SPUD_PSEAE -
5 PsiBlast_PDB 85.2156%-102 - C2 -4JDF - POTF_ECOLI -
21 PsiBlast_CBE 84.9058% -91 - C2 -3TTM 2.9 SPUD_PSEAE
3 PsiBlast_PDB 84.7358% -91 - C2 -3TTM - SPUD_PSEAE -
23 PsiBlast_CBE 84.5256% -95 - C2 -1A99 - POTF_ECOLI -
31 HHSearch 83.8559% -89 - C2 -3TTM 3.0 SPUD_PSEAE
6 PsiBlast_PDB 83.7656% -96 - C2 -1A99 - POTF_ECOLI -
50 Fugue 83.6056% -95 - C2 -1A99 - POTF_ECOLI -
22 PsiBlast_CBE 83.0656% -94 - C2 -1A99 - POTF_ECOLI -
24 PsiBlast_CBE 82.6956% -93 - C2 -1A99 - POTF_ECOLI -
25 PsiBlast_CBE 69.4533% -88 - C2 -4EQB - ? -
8 PsiBlast_PDB 69.4333% -89 - C2 -4EQB - ? -
32 HHSearch 68.2636% -76 - C2 -1POT - POTD_ECOLI -
7 PsiBlast_PDB 67.1737% -82 - C2 -1POT - POTD_ECOLI -
9 PsiBlast_PDB 67.0936% -78 - C2 -4GL0 - ? -
10 PsiBlast_PDB 64.3631%-116 - C2 -2V84 - ? -
33 HHSearch 62.1828% -90 * C2 *2V84 - ? -