@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0350: (2016-01-01 )
MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIMGRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELMLIGGAQLYAEALPRAARLYLTRVGLAPEGDAFFPEIDGAAWRLASSIEHAAADDAPAYAFEVWERR

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MTX_C_10(3IA4)
?
[Raw transfer]




MTX_B_8(3IA4)
?
[Raw transfer]




25U_A_3(4OR7)
?
[Raw transfer]




06U_C_13(4OSG)
?
[Raw transfer]




9DR_A_4(3SAI)
?
[Raw transfer]




5DR_A_4(3S9U)
?
[Raw transfer]




EKB_B_6(3JVX)
?
[Raw transfer]




6DR_A_4(3SA1)
?
[Raw transfer]




7DR_B_6(3SA2)
?
[Raw transfer]




9DR_B_10(3SAI)
?
[Raw transfer]




5DR_A_4(3S9U)
?
[Raw transfer]




EKB_A_4(3JVX)
?
[Raw transfer]




MTX_A_6(4DFR)
DYR_ECOLI
[Raw transfer]




TOP_A_3(2W9H)
DYR_STAAU
[Raw transfer]




7DR_A_4(3SA2)
?
[Raw transfer]




5WA_B_6(3JWF)
?
[Raw transfer]




N22_B_6(3E0B)
?
[Raw transfer]




5WB_B_6(3JWK)
?
[Raw transfer]




5WB_A_4(3JWK)
?
[Raw transfer]




6DR_B_6(3SA1)
?
[Raw transfer]




GW3_A_4(1AOE)
DYR_CANAX
[Raw transfer]




5WB_A_4(3JWM)
?
[Raw transfer]




06U_D_19(4OSG)
?
[Raw transfer]




FOL_B_9(4EJ1)
DYR_ECOLI
[Raw transfer]




5WB_B_6(3JWM)
?
[Raw transfer]




N22_A_4(3E0B)
?
[Raw transfer]




FOL_A_3(4FHB)
DYR_ECOLI
[Raw transfer]




FOL_A_3(4I1N)
DYR_ECOLI
[Raw transfer]




FOL_A_3(4I13)
DYR_ECOLI
[Raw transfer]




FOL_A_5(4EJ1)
DYR_ECOLI
[Raw transfer]




MTX_A_2(3DAT)
?
[Raw transfer]




WRA_A_4(3RG9)
DRTS_TRYBB
[Raw transfer]




TOP_B_6(3JW3)
?
[Raw transfer]




WRA_A_4(3RG9)
DRTS_TRYBB
[Raw transfer]




MTX_A_2(2QK8)
?
[Raw transfer]




NAP_B_8(4OSG)
?
[Raw transfer]




NDP_A_4(1KMV)
DYR_HUMAN
[Raw transfer]




TOP_B_6(3JW5)
?
[Raw transfer]




NAP_B_6(2ZZA)
?
[Raw transfer]




NAP_D_18(4OSG)
?
[Raw transfer]




NAP_X_3(3NZB)
DYR_PNECA
[Raw transfer]




NDP_A_2(3TQ9)
?
[Raw transfer]




NDP_D_11(3IA4)
?
[Raw transfer]




NAP_C_12(4OSG)
?
[Raw transfer]




NAP_A_5(4OSG)
?
[Raw transfer]




NAP_A_3(3JW3)
?
[Raw transfer]




NAP_A_2(4OR7)
?
[Raw transfer]




NDP_A_2(3TQ8)
?
[Raw transfer]




NDP_A_2(3TQ8)
?
[Raw transfer]




NAP_A_3(2ZZA)
?
[Raw transfer]




NDP_A_2(2BL9)
DRTS_PLAVI
[Raw transfer]




NDP_A_2(3TQB)
?
[Raw transfer]




NAP_A_4(4FHB)
DYR_ECOLI
[Raw transfer]




NDP_B_7(3IA4)
?
[Raw transfer]




NDP_A_2(3TQA)
?
[Raw transfer]




NDP_C_9(3IA4)
?
[Raw transfer]




MTX_A_4(3IX9)
DYR_STRPN
[Raw transfer]




22 PsiBlast_CBE 95.8548%-133 - C3 -3IA5 - ? -
24 PsiBlast_CBE 95.7448%-126 - C3 -3IA4 10.0 ?
25 PsiBlast_CBE 95.2048%-125 - C3 -3IA4 9.0 ?
23 PsiBlast_CBE 93.6848%-124 - C3 -3IA4 9.9 ?
103 HHSearch 93.5344%-123 - C3 -3TQ8 12.4 ?
1 PsiBlast_PDB 93.0845%-127 - C3 -3TQ8 12.4 ?
4 PsiBlast_PDB 92.9145%-131 - C3 -3TQB 11.6 ?
6 PsiBlast_PDB 92.8048%-131 - C3 -3IA5 - ? -
2 PsiBlast_PDB 92.4945%-132 - C3 -3TQ9 12.0 ?
21 PsiBlast_CBE 91.1848%-123 - C3 -2ZZA 8.9 ?
5 PsiBlast_PDB 91.0048%-121 - C3 -2ZZA 9.3 ?
3 PsiBlast_PDB 90.2445%-128 - C3 -3TQA 11.8 ?
100 PsiBlast_CBE 87.6544%-114 - C3 -4FHB 8.4 DYR_ECOLI
64 PsiBlast_CBE 87.3240%-122 - C3 -4ELE - ? -
70 PsiBlast_CBE 87.1140%-118 - C3 -4ELB - ? -
49 PsiBlast_CBE 87.0940%-122 - C3 -4ELG - ? -
66 PsiBlast_CBE 87.0840%-122 - C3 -4ELB - ? -
46 PsiBlast_CBE 87.0840%-122 - C3 -4ELG - ? -
97 PsiBlast_CBE 86.9444%-110 - C3 -4OR7 11.4 ?
88 PsiBlast_CBE 86.9239%-114 - C3 -3JWF - ? -
99 PsiBlast_CBE 86.8144%-107 - C3 -4I13 7.4 DYR_ECOLI
86 PsiBlast_CBE 86.5939%-116 - C3 -3JWK 4.5 ?
31 PsiBlast_CBE 86.4340%-116 - C3 -3E0B 4.9 ?
85 PsiBlast_CBE 86.3139%-114 - C3 -3JWK 4.6 ?
101 PsiBlast_CBE 86.3044%-107 - C3 -4EJ1 7.9 DYR_ECOLI
108 HHSearch 86.2238%-117 - C3 -1KMV 8.5 DYR_HUMAN
98 PsiBlast_CBE 86.1644%-109 - C3 -4I1N 8.1 DYR_ECOLI
15 PsiBlast_PDB 86.1340%-115 - C3 -3JVX 5.7 ?
104 HHSearch 86.0840%-105 - C3 -3S9U 6.1 ?
33 PsiBlast_CBE 85.9540%-117 - C3 -3JVX 5.6 ?
87 PsiBlast_CBE 85.9039%-113 - C3 -3JWF 5.0 ?
28 PsiBlast_CBE 85.6040%-117 - C3 -3SA2 6.8 ?
29 PsiBlast_CBE 85.3540%-112 - C3 -3SA1 6.2 ?
27 PsiBlast_CBE 85.3440%-112 - C3 -3SAI 6.2 ?
11 PsiBlast_PDB 85.3240%-113 - C3 -3SAI 6.2 ?
8 PsiBlast_PDB 84.9540%-113 - C3 -3S9U 6.1 ?
10 PsiBlast_PDB 84.8540%-113 - C3 -3SA2 6.5 ?
16 PsiBlast_PDB 84.7340%-115 - C3 -3JWM 5.0 ?
94 PsiBlast_CBE 84.7044%-108 - C3 -4OSG 9.6 ?
7 PsiBlast_PDB 84.5740%-115 - C3 -3JW3 11.9 ?
91 PsiBlast_CBE 84.4939%-113 * C3 *3JW5 3.9 ?
26 PsiBlast_CBE 84.4840%-117 - C3 -3JW3 3.5 ?
12 PsiBlast_PDB 84.1840%-115 - C3 -3E0B 5.1 ?
96 PsiBlast_CBE 84.1144%-112 - C3 -4OSG 7.2 ?
14 PsiBlast_PDB 84.0740%-111 - C3 -3DAT 8.5 ?
32 PsiBlast_CBE 83.9540%-116 - C3 -3JWM 4.5 ?
9 PsiBlast_PDB 83.6440%-113 - C3 -3SA1 6.4 ?
102 PsiBlast_CBE 83.6344%-107 - C3 -4EJ1 7.9 DYR_ECOLI
124 Fugue 83.4643%-110 - C3 -4DFR 7.9 DYR_ECOLI
93 PsiBlast_CBE 82.8944%-103 - C3 -4OSG 7.4 ?
95 PsiBlast_CBE 82.6044%-103 - C3 -4OSG 7.7 ?
13 PsiBlast_PDB 82.3640%-116 - C3 -2QK8 8.1 ?
110 HHSearch 79.6233%-115 - C3 -2W9H 4.0 DYR_STAAU
113 HHSearch 77.2635% -92 - C3 -3NZB 11.8 DYR_PNECA
111 HHSearch 77.1031% -89 - C3 -3IX9 8.1 DYR_STRPN
112 HHSearch 76.8731%-110 - C3 -1AOE 5.2 DYR_CANAX
116 HHSearch 75.3332% -91 - C3 -3RG9 5.6 DRTS_TRYBB
107 HHSearch 74.4731% -89 - C3 -2BL9 10.2 DRTS_PLAVI
125 Fugue 74.2830% -98 - C3 -3RG9 5.7 DRTS_TRYBB