@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0357: (2016-01-01 )
MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVRLSGQRIVSVERRAKYLLLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGMALRYTDPRRFGAMLWSLAPLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIMDNAVVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTLRDFVGGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR

Atome Classification :

(34 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_B_2(1TDH)
NEIL1_HUMAN
[Raw transfer]




NACID_H_7(1K82)
FPG_ECOLI
[Raw transfer]

-

GOL_A_5(3C58)
FPG_LACLC
[Raw transfer]




GOL_A_5(2XZF)
FPG_LACLC
[Raw transfer]




BU3_A_6(4CIS)
?
[Raw transfer]




GOL_A_2(3TWL)
FPG_ARATH
[Raw transfer]




GOL_A_5(1TDZ)
FPG_LACLC
[Raw transfer]




GOL_D_8(3SAR)
?
[Raw transfer]




GOL_A_5(3JR5)
?
[Raw transfer]




GOL_A_7(1PJJ)
FPG_LACLC
[Raw transfer]




GOL_A_5(4PCZ)
FPG_LACLC
[Raw transfer]




GOL_A_5(2XZU)
FPG_LACLC
[Raw transfer]




NACID_G_5(1K82)
FPG_ECOLI
[Raw transfer]

-

NACID_C_3(3SAS)
?
[Raw transfer]

-

GOL_A_5(1NNJ)
FPG_LACLC
[Raw transfer]




NACID_E_1(1K82)
FPG_ECOLI
[Raw transfer]

-

GOL_A_5(1XC8)
FPG_LACLC
[Raw transfer]




NACID_E_1(1K82)
FPG_ECOLI
[Raw transfer]

-

NACID_E_1(1K82)
FPG_ECOLI
[Raw transfer]

-

GOL_A_7(1PM5)
FPG_LACLC
[Raw transfer]




GOL_A_5(1PJI)
FPG_LACLC
[Raw transfer]




NACID_F_3(1K82)
FPG_ECOLI
[Raw transfer]

-

NACID_C_2(1L2B)
?
[Raw transfer]

-

NACID_C_3(3GPY)
?
[Raw transfer]

-

NACID_D_3(3SAR)
?
[Raw transfer]

-

22 PsiBlast_CBE 92.7354%-101 - C12 -1K82 6.8 FPG_ECOLI
23 PsiBlast_CBE 92.4454%-104 - C12 -1K82 7.2 FPG_ECOLI
1 PsiBlast_PDB 92.1654% -99 - C12 -1K82 6.0 FPG_ECOLI
68 Fugue 92.0855% -95 - C12 -1K82 6.0 FPG_ECOLI
21 PsiBlast_CBE 91.4754% -99 - C12 -1K82 7.4 FPG_ECOLI
78 HHSearch 90.6654% -90 - C12 -1K82 6.0 FPG_ECOLI
12 PsiBlast_PDB 85.3240% -85 - C12 -2F5Q - ? -
19 PsiBlast_PDB 85.0340% -84 - C12 -3GPY 7.1 ?
11 PsiBlast_PDB 84.7540% -86 - C12 -1R2Z - ? -
10 PsiBlast_PDB 84.5340% -85 - C12 -1R2Y - ? -
6 PsiBlast_PDB 83.7740% -89 - C12 -1L2D - ? -
20 PsiBlast_PDB 83.7540% -85 - C12 -3GQ4 - ? -
40 PsiBlast_CBE 83.4539% -85 - C12 -3JR5 3.0 ?
13 PsiBlast_PDB 83.4240% -86 - C12 -2F5S - ? -
41 PsiBlast_CBE 83.1139% -88 - C12 -3JR4 - ? -
30 PsiBlast_CBE 83.0040% -94 - C12 -3U6S - ? -
8 PsiBlast_PDB 82.9440% -96 - C12 -2F5O - ? -
32 PsiBlast_CBE 82.9040% -95 - C12 -3U6P - ? -
5 PsiBlast_PDB 82.8240% -89 - C12 -1L2C - ? -
16 PsiBlast_PDB 82.7540% -96 - C12 -3SAV - ? -
14 PsiBlast_PDB 82.6540% -97 - C12 -3SAR 6.0 ?
4 PsiBlast_PDB 81.9540% -89 - C12 -1L2B 4.2 ?
28 PsiBlast_CBE 81.7440% -92 - C12 -3SAS 3.0 ?
49 PsiBlast_CBE 80.3035% -77 - C12 -3C58 1.9 FPG_LACLC
51 PsiBlast_CBE 80.2735% -77 - C12 -2XZF 3.1 FPG_LACLC
46 PsiBlast_CBE 80.1635% -84 - C12 -4CIS 3.3 ?
44 PsiBlast_CBE 80.1035% -82 - C12 -1TDZ 3.2 FPG_LACLC
50 PsiBlast_CBE 79.3635% -76 - C12 -2XZU 3.1 FPG_LACLC
52 PsiBlast_CBE 79.3335% -77 - C12 -1XC8 3.0 FPG_LACLC
53 PsiBlast_CBE 79.1635% -75 - C12 -1PM5 2.7 FPG_LACLC
54 PsiBlast_CBE 79.1135% -79 - C12 -1PJI 1.9 FPG_LACLC
60 PsiBlast_CBE 78.1235% -79 - C12 -1PJJ 2.9 FPG_LACLC
61 PsiBlast_CBE 78.0435% -82 - C12 -1NNJ 1.9 FPG_LACLC
55 PsiBlast_CBE 76.8535% -78 - C12 -4PCZ 3.0 FPG_LACLC