@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0456: (2016-01-05 )
MSRQNGTVKWFNETKGYGFITPESGPDVFVHFRAIEGNGFKTLAEGQKVSFEVVQGQKGMQAERVQVIN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_A_5(1C9O)
CSPB_BACCL
[Raw transfer]




TRS_A_7(1C9O)
CSPB_BACCL
[Raw transfer]




TRS_A_7(1C9O)
CSPB_BACCL
[Raw transfer]




54 Fugue 89.6566%-118 - C5 -1C9O 3.1 CSPB_BACCL
2 PsiBlast_PDB 88.8169%-128 - C5 -1I5F - CSPB_BACCL -
67 HHSearch 88.3665%-117 - C5 -1C9O 3.1 CSPB_BACCL
8 PsiBlast_PDB 88.2969%-127 - C5 -1HZC - CSPB_BACCL -
14 PsiBlast_PDB 86.7165%-128 - C5 -1CSP - CSPB_BACSU -
19 PsiBlast_PDB 86.6765%-129 - C5 -3PF5 - CSPB_BACSU -
1 PsiBlast_PDB 86.3363%-107 - C5 -3I2Z - ? -
7 PsiBlast_PDB 86.0669%-119 - C5 -1HZ9 - CSPB_BACCL -
24 PsiBlast_CBE 85.6365%-138 - C5 -3PF5 - CSPB_BACSU -
5 PsiBlast_PDB 85.5669%-121 - C5 -1HZA - CSPB_BACCL -
15 PsiBlast_PDB 85.0065%-130 - C5 -1CSQ - CSPB_BACSU -
18 PsiBlast_PDB 84.8665%-130 - C5 -3PF4 - CSPB_BACSU -
3 PsiBlast_PDB 84.7769%-129 - C5 -1C9O 2.7 CSPB_BACCL
6 PsiBlast_PDB 84.7669%-124 - C5 -1HZB - CSPB_BACCL -
25 PsiBlast_CBE 84.2265%-136 - C5 -3PF4 - CSPB_BACSU -
64 HHSearch 83.7762%-107 - C5 -3I2Z - ? -
23 PsiBlast_CBE 82.1369%-119 - C5 -1HZB - CSPB_BACCL -
12 PsiBlast_PDB 82.0765%-140 - C5 -2ES2 - CSPB_BACSU -
13 PsiBlast_PDB 81.6365%-149 - C5 -2F52 - CSPB_BACSU -
29 PsiBlast_CBE 81.4039%-135 - C5 -4A76 - ? -