@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0548: (2016-01-09 )
MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYMQHNPSNPQWANRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKNFRQLNSRTPGHPEYGYTAGVETTTGPLGQGIANAVGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGISHEVASLAGTLRLNKLIAFYDDNGISIDGEVHGWFTDDTPKRFEAYGWQVIRNVDGHDADEIKTAIDTARKSDQPTLICCKTVIGFGSPNKQGKEECHGAPLGADEIAATRAALGWEHAPFEIPAQIYAEWDAKETGAAQEAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKAAAYVADVANKGETIASRKASQNALNAFGPLLPELLGGSADLAGSNLTLWKGCKGVSADDAAGNYVFYGVREFGMSAIMNGVALHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYVFTHDSIGLGEDGPTHQPIEQLASLRLTPNLDTWRPADAVESAVAWKHAIERADGPSALIFSRQNLPHQARDVAQVADIARGGYVLKDCEGEPELILIATGSEVGLAVQAYDKLSEQGRKVRVVSMPCTSVYEQQDESYKQSVLPVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSFGESAPAPALFEHFGFTLDNVLAVAEELLED

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TPP_A_3(4C7X)
?
[Raw transfer]
1 PsiBlast_PDB 96.86100% -95 - C1 -4XEU - ? -
3 PsiBlast_PDB 89.7773% -86 - C1 -2R8O - TKT1_ECOLI -
5 PsiBlast_PDB 89.6472% -86 - C1 -1QGD - TKT1_ECOLI -
4 PsiBlast_PDB 89.5473% -83 - C1 -2R8P - TKT1_ECOLI -
2 PsiBlast_PDB 89.4673% -83 - C1 -2R5N - TKT1_ECOLI -
22 PsiBlast_CBE 89.2073% -84 - C1 -2R8O - TKT1_ECOLI -
23 PsiBlast_CBE 89.1173% -83 - C1 -2R5N - TKT1_ECOLI -
21 PsiBlast_CBE 88.7673% -83 - C1 -2R8P - TKT1_ECOLI -
24 PsiBlast_CBE 88.6872% -84 - C1 -1QGD - TKT1_ECOLI -
25 PsiBlast_CBE 84.8164% -84 - C1 -3UPT - ? -
6 PsiBlast_PDB 84.7564% -84 - C1 -3UPT - ? -
16 PsiBlast_PDB 80.3748% -84 - C1 -1TRK - TKT1_YEAST -
26 PsiBlast_CBE 80.0150% -77 - C1 -1ITZ - TKTC_MAIZE -
7 PsiBlast_PDB 79.9050% -78 - C1 -1ITZ - TKTC_MAIZE -
12 PsiBlast_PDB 79.8749% -80 - C1 -3M49 - ? -
11 PsiBlast_PDB 79.8049% -80 - C1 -3HYL - ? -
34 PsiBlast_CBE 79.7648% -83 - C1 -1AY0 - TKT1_YEAST -
55 HHSearch 79.7151% -75 - C1 -3M49 - ? -
27 PsiBlast_CBE 79.6950% -77 - C1 -1ITZ - TKTC_MAIZE -
31 PsiBlast_CBE 79.3748% -84 - C1 -1TRK - TKT1_YEAST -
10 PsiBlast_PDB 76.5848% -79 - C1 -4C7X 5.9 ?