@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0710: (2016-01-16 )
MRILHSMLRVADLEAALEFYTRALDMRLLRRRDYPEGRFTLAFVGYQDERAAAALELTHNWDRDGYTQGDGYGHLAIEVEDAAVTCARARALGYRVTREAGLMQHGRSVIAFLEDPDGYKVELIQKGTQFD

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_6(4MTT)
?
[Raw transfer]



MPD_D_16(2C21)
?
[Raw transfer]



MPD_A_9(2C21)
?
[Raw transfer]



MPD_D_18(2C21)
?
[Raw transfer]



MPD_B_11(2C21)
?
[Raw transfer]
3 PsiBlast_PDB 96.42100%-122 - C1 -4MTT 3.3 ?
22 PsiBlast_CBE 95.52100%-118 - C1 -4MTS - ? -
24 PsiBlast_CBE 94.59100%-123 - C1 -4MTQ - ? -
23 PsiBlast_CBE 94.49100%-136 - C1 -4MTR - ? -
21 PsiBlast_CBE 93.76100%-118 - C1 -4MTT - ? -
2 PsiBlast_PDB 93.20100%-116 - C1 -4MTS - ? -
1 PsiBlast_PDB 92.62100%-127 - C1 -4MTQ - ? -
5 PsiBlast_PDB 82.3953%-116 - C1 -1FA5 - LGUL_ECOLI -
4 PsiBlast_PDB 82.0253%-118 - C1 -1F9Z - LGUL_ECOLI -
28 PsiBlast_CBE 80.9053%-117 - C1 -1F9Z - LGUL_ECOLI -
7 PsiBlast_PDB 80.5853%-119 - C1 -1FA7 - LGUL_ECOLI -
27 PsiBlast_CBE 80.5353%-117 - C1 -1FA5 - LGUL_ECOLI -
26 PsiBlast_CBE 80.3153%-119 - C1 -1FA6 - LGUL_ECOLI -
8 PsiBlast_PDB 80.2853%-116 - C1 -1FA8 - LGUL_ECOLI -
6 PsiBlast_PDB 78.5053%-115 - C1 -1FA6 - LGUL_ECOLI -
25 PsiBlast_CBE 78.1753%-114 - C1 -1FA7 - LGUL_ECOLI -
9 PsiBlast_PDB 77.3543%-109 - C1 -5D7Z - ? -
57 PsiBlast_CBE 76.4434%-114 - C1 -1BH5 - LGUL_HUMAN -
39 PsiBlast_CBE 76.0334%-119 - C1 -4PV5 - LGUL_MOUSE -
51 PsiBlast_CBE 75.4734%-110 - C1 -3W0T - LGUL_HUMAN -
31 PsiBlast_CBE 74.1840%-112 - C1 -2C21 2.5 ?
32 PsiBlast_CBE 73.6940%-112 - C1 -2C21 3.2 ?
33 PsiBlast_CBE 72.4140%-112 - C1 -2C21 3.2 ?