Study : PA0750 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C8_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C8_S1
Complex: GOL_B_5(1OKB) / Model_36(1OKB/B) = [3.1] Download332.7120.86MTDNDDRIKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL
Complex: URF_A_2(4WS1) / Model_48(4WS1/A) = [3.1] Download221.9017.40MTDNDDRIKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL
Complex: CIT_A_2(4WRY) / Model_51(4WRY/A) = [3.1] Download937.6321.50MTDNDDRIKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL
Complex: TUL_A_2(4WS8) / Model_41(4WS8/A) = [3.1] Download435.2822.19MTDNDDRIKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL
Complex: URA_B_2(2EUG) / Model_12(2EUG/A) = [3.1] Download458.7614.76MTDNDDRIKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL
Consensus
[pKd Mean = 3.10]
-477
(s=245)
19
(s=2)
MTDNDDRIKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL