@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0750: (2016-01-17 )
MTDNDDRIKLEASWKEALREEFDKPYMKQLGEFLRQEKAAGKVIFPPGPLIFNALNTTPLENVKVVIIGQDPYHGPGQAHGLCFSVQPGVPTPPSLQNIYKELNRDLNIPIPNNGYLQRWAEQGVLLLNTSLTVEQAKAGSHANAGWQPFTDRVIEVVNERCERLVFLLWGSHAQSKQKLIDPQRHLILKSAHPSPLSAYRGFLGNGHFSRTNKFLEQNGKTPIDWSLPDL

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FCF_A_2(3FCF)
UNG_HUMAN
[Raw transfer]




302_B_2(2HXM)
UNG_HUMAN
[Raw transfer]




3FI_A_2(3FCI)
UNG_HUMAN
[Raw transfer]




3FI_A_2(3FCI)
UNG_HUMAN
[Raw transfer]




5NU_A_2(4WS5)
?
[Raw transfer]




3FL_B_8(3FCL)
UNG_HUMAN
[Raw transfer]




3FL_A_3(3FCL)
UNG_HUMAN
[Raw transfer]




URA_B_2(5EUG)
UNG_ECOLI
[Raw transfer]




URA_B_2(2EUG)
UNG_ECOLI
[Raw transfer]




GOL_B_2(3EUG)
UNG_ECOLI
[Raw transfer]




5NU_A_4(4WS4)
?
[Raw transfer]




GOL_A_3(1OKB)
?
[Raw transfer]




URA_A_2(4WPL)
?
[Raw transfer]




URA_A_2(4WRU)
?
[Raw transfer]




GOL_B_5(1OKB)
?
[Raw transfer]




URF_A_2(4WS0)
?
[Raw transfer]




6UA_A_4(4WS2)
?
[Raw transfer]




GOL_A_8(4WRW)
?
[Raw transfer]




URF_A_2(4WS1)
?
[Raw transfer]




URA_D_4(1UDH)
UNG_HHV11
[Raw transfer]




URA_A_2(4WRV)
?
[Raw transfer]




6UA_A_2(4WS3)
?
[Raw transfer]




FCK_B_2(3FCK)
UNG_HUMAN
[Raw transfer]




DUR_A_2(2C53)
UNG_HHV11
[Raw transfer]




URA_B_2(1FLZ)
UNG_ECOLI
[Raw transfer]




GOL_A_4(3ZOQ)
UNG_BACSU
[Raw transfer]




5UC_A_2(4WS7)
?
[Raw transfer]




URB_A_3(3CXM)
?
[Raw transfer]




URB_A_3(3CXM)
?
[Raw transfer]




TUL_A_2(4WS8)
?
[Raw transfer]




NACID_B_2(4UQM)
?
[Raw transfer]

-

FLC_A_2(3A7N)
UNG_MYCTU
[Raw transfer]




CIT_A_2(4WRY)
?
[Raw transfer]




CIT_A_2(4WPK)
?
[Raw transfer]




CIT_A_4(4WS6)
?
[Raw transfer]




CIT_A_3(4WS4)
?
[Raw transfer]




NACID_A_1(2SSP)
UNG_HUMAN
[Raw transfer]

-

CIT_A_3(4WS2)
?
[Raw transfer]




NACID_D_1(1LAU)
UNG_HHV11
[Raw transfer]

-

NACID_B_1(1EMJ)
UNG_HUMAN
[Raw transfer]

-

NACID_C_2(1EMH)
UNG_HUMAN
[Raw transfer]

-

CIT_A_2(4WRZ)
?
[Raw transfer]




NACID_A_1(1SSP)
UNG_HUMAN
[Raw transfer]

-

IMD_A_3(3TKB)
UNG_HUMAN
[Raw transfer]




DMS_A_5(4WPL)
?
[Raw transfer]




NACID_B_1(2OXM)
UNG_HUMAN
[Raw transfer]

-

CHAIN_C_2(2OYT)
UNG_HUMAN
[Raw transfer]

-

CHAIN_C_3(3UF7)
UNG_ECOLI
[Raw transfer]

-

NACID_C_2(1Q3F)
UNG_HUMAN
[Raw transfer]

-

NACID_A_1(4SKN)
UNG_HUMAN
[Raw transfer]

-

NACID_B_1(1EMH)
UNG_HUMAN
[Raw transfer]

-

URE_D_6(2J8X)
UNG_EBVB9
[Raw transfer]




CHAIN_C_3(3UF7)
UNG_ECOLI
[Raw transfer]

-

URE_B_5(2J8X)
UNG_EBVB9
[Raw transfer]




URE_B_5(2J8X)
UNG_EBVB9
[Raw transfer]




3 PsiBlast_PDB 93.4454% -94 - C8 -3ZOQ 2.6 UNG_BACSU
4 PsiBlast_PDB 93.3454% -92 - C8 -3ZOR - UNG_BACSU -
2 PsiBlast_PDB 93.2758% -89 - C8 -2JHQ - UNG_VIBCH -
6 PsiBlast_PDB 92.8756% -91 - C8 -1UUG - UNG_ECOLI -
66 Fugue 92.8355% -89 - C8 -1UUG - UNG_ECOLI -
15 PsiBlast_PDB 92.6755% -94 - C8 -4EUG - UNG_ECOLI -
13 PsiBlast_PDB 92.4855% -90 - C8 -3EUG 2.7 UNG_ECOLI
24 PsiBlast_CBE 92.4753% -91 - C8 -3FCI 6.3 UNG_HUMAN
20 PsiBlast_PDB 92.4755% -88 - C8 -2BOO - UNG_DEIRA -
32 PsiBlast_CBE 92.1253% -93 - C8 -1EMH 10.6 UNG_HUMAN
5 PsiBlast_PDB 92.0756% -92 - C8 -1EUG - UNG_ECOLI -
26 PsiBlast_CBE 92.0353% -91 - C8 -2OYT 2.1 UNG_HUMAN
29 PsiBlast_CBE 91.9453% -90 - C8 -1SSP 7.4 UNG_HUMAN
25 PsiBlast_CBE 91.8853% -90 - C8 -3FCF 6.9 UNG_HUMAN
34 PsiBlast_CBE 91.7753% -89 - C8 -2SSP 6.3 UNG_HUMAN
21 PsiBlast_CBE 91.7453% -91 - C8 -3FCL 5.8 UNG_HUMAN
19 PsiBlast_PDB 91.7155% -93 - C8 -3UFM - UNG_DEIRA -
76 HHSearch 91.6652% -88 * C8 *3FCI 6.3 UNG_HUMAN
77 HHSearch 91.6455% -89 - C8 -3UF7 5.1 UNG_ECOLI
23 PsiBlast_CBE 91.6153% -91 - C8 -3FCK 4.4 UNG_HUMAN
28 PsiBlast_CBE 91.5353% -88 - C8 -2HXM 7.3 UNG_HUMAN
27 PsiBlast_CBE 91.4453% -89 - C8 -2OXM 7.6 UNG_HUMAN
16 PsiBlast_PDB 91.3355% -89 - C8 -5EUG 3.3 UNG_ECOLI
11 PsiBlast_PDB 91.3356% -89 - C8 -3UF7 5.1 UNG_ECOLI
30 PsiBlast_CBE 91.1453% -90 - C8 -1Q3F 2.8 UNG_HUMAN
12 PsiBlast_PDB 91.0855% -91 - C8 -2EUG 3.1 UNG_ECOLI
33 PsiBlast_CBE 91.0753% -86 - C8 -3TKB 3.8 UNG_HUMAN
18 PsiBlast_PDB 90.9856% -84 - C8 -4UQM 8.8 ?
37 PsiBlast_CBE 90.9451% -85 - C8 -1OKB 3.2 ?
36 PsiBlast_CBE 90.9051% -85 - C8 -1OKB 3.1 ?
31 PsiBlast_CBE 90.7953% -91 - C8 -1EMJ 8.8 UNG_HUMAN
22 PsiBlast_CBE 90.7953% -87 - C8 -3FCL 5.5 UNG_HUMAN
14 PsiBlast_PDB 90.6955% -90 - C8 -1FLZ 3.6 UNG_ECOLI
35 PsiBlast_CBE 90.6053% -89 - C8 -4SKN 9.3 UNG_HUMAN
78 HHSearch 89.7250% -83 - C8 -3CXM 3.3 ?
44 PsiBlast_CBE 89.2044% -97 - C8 -4WS5 3.7 ?
58 PsiBlast_CBE 89.0744% -94 - C8 -3A7N 2.5 UNG_MYCTU
55 PsiBlast_CBE 88.3444% -91 - C8 -4WRU 3.4 ?
80 HHSearch 88.0945% -88 - C8 -2J8X 2.8 UNG_EBVB9
48 PsiBlast_CBE 87.8644% -92 - C8 -4WS1 3.1 ?
49 PsiBlast_CBE 87.8344% -90 - C8 -4WS0 3.4 ?
42 PsiBlast_CBE 87.7944% -89 - C8 -4WS7 3.3 ?
57 PsiBlast_CBE 87.4344% -90 - C8 -4WPK 2.0 ?
41 PsiBlast_CBE 87.3244% -89 - C8 -4WS8 3.1 ?
38 PsiBlast_CBE 87.2951% -89 - C8 -3CXM 3.3 ?
47 PsiBlast_CBE 87.2244% -92 - C8 -4WS2 3.7 ?
56 PsiBlast_CBE 87.1644% -92 - C8 -4WPL 3.5 ?
54 PsiBlast_CBE 87.1444% -87 - C8 -4WRV 3.4 ?
50 PsiBlast_CBE 87.0744% -92 - C8 -4WRZ 1.9 ?
43 PsiBlast_CBE 86.5544% -90 - C8 -4WS6 2.9 ?
45 PsiBlast_CBE 86.5444% -89 - C8 -4WS4 4.0 ?
46 PsiBlast_CBE 86.4944% -89 - C8 -4WS3 3.6 ?
51 PsiBlast_CBE 86.4044% -89 - C8 -4WRY 3.1 ?
53 PsiBlast_CBE 85.3044% -85 - C8 -4WRW 2.6 ?
61 PsiBlast_CBE 84.4941% -86 - C8 -1LAU 5.9 UNG_HHV11
59 PsiBlast_CBE 84.2741% -83 - C8 -1UDH 3.5 UNG_HHV11
65 PsiBlast_CBE 82.9140% -90 - C8 -2C53 3.9 UNG_HHV11
39 PsiBlast_CBE 82.4154%-102 - C8 -2J8X 2.8 UNG_EBVB9
40 PsiBlast_CBE 81.9654% -99 - C8 -2J8X 2.8 UNG_EBVB9