@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0807: (2016-01-20 )
MLTIDYNSYRTTTPYGKRVRFLVLHYTALDFAASVKALTTGAASAHYLIPAPHDPSYKAAGFKGQRIFNLVAEEDRAWHAGVSGWARRDNLNDTSIGIEIVNLARDDDGVFTFPDYERSQINALKQLAKNILQRYPDMTPKNVVGHSDIAVGRKSDPGPKLPWKELYEAGIGAWYDDATRDRYREGFERDGLPPRADLLEAFRLYGYALPATVDDAYFASLLRAFQMHFRPENYDGALDVETAAILYALNEKYPA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

J0J_B_6(4BOL)
?
[Raw transfer]




CHAIN_C_3(4BXE)
?
[Raw transfer]

-

CHAIN_C_3(4BXD)
?
[Raw transfer]

-

CHAIN_B_2(3D2Y)
AMID_ECOLI
[Raw transfer]

-

CHAIN_B_2(3D2Y)
AMID_ECOLI
[Raw transfer]

-

2 PsiBlast_PDB 99.63100%-111 - C2 -4BXJ - ? -
16 PsiBlast_CBE 97.79100%-108 - C2 -4BXJ - ? -
1 PsiBlast_PDB 97.30100%-104 - C2 -4BXE - ? -
17 PsiBlast_CBE 96.78100%-104 - C2 -4BXE 3.3 ?
18 PsiBlast_CBE 95.66100%-102 - C2 -4BXD 1.9 ?
51 Fugue 74.4142% -92 - C2 -3D2Y 6.7 AMID_ECOLI
3 PsiBlast_PDB 73.3045% -94 - C2 -3D2Y - AMID_ECOLI -
28 HHSearch 73.2445% -91 - C2 -3D2Y 6.7 AMID_ECOLI
5 PsiBlast_PDB 73.2245% -96 - C2 -2WKX - AMID_ECOLI -
4 PsiBlast_PDB 73.0745% -93 - C2 -3D2Z - AMID_ECOLI -
6 PsiBlast_PDB 71.9945% -91 - C2 -2BH7 - AMID_ECOLI -
19 PsiBlast_CBE 70.5641% -97 - C2 -4BJ4 - ? -
7 PsiBlast_PDB 70.0441% -93 - C2 -4BJ4 - ? -
21 PsiBlast_CBE 69.0441% -92 - C2 -4BOL 4.6 ?
20 PsiBlast_CBE 68.9141% -92 - C2 -4BPA - ? -
8 PsiBlast_PDB 68.2541% -92 - C2 -4BPA - ? -
40 HHSearch 41.4520% -87 - C2 -1LBA - ENLYS_BPT7 -
30 HHSearch 41.0324% -79 - C2 -3RDR - XLYA_BACSU -
35 HHSearch 39.6118%-102 - C2 -1SK4 - -
36 HHSearch 39.5122% -84 - C2 -1YCK - PGRP1_HUMAN -